Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIQGW6U)

DOT Name	Cancer/testis antigen 1 (CTAG1B)
Synonyms	Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer/testis antigen 6.1; CT6.1; L antigen family member 2; LAGE-2
Gene Name	CTAG1B
Related Disease	Meningioma ( ) Ovarian cancer ( ) Adult glioblastoma ( ) Adult T-cell leukemia/lymphoma ( ) Breast cancer ( ) Breast carcinoma ( ) Breast neoplasm ( ) Carcinoma of esophagus ( ) Clear cell renal carcinoma ( ) Epithelial ovarian cancer ( ) Esophageal cancer ( ) Esophageal squamous cell carcinoma ( ) Glioblastoma multiforme ( ) Glioma ( ) Hepatocellular carcinoma ( ) Liposarcoma ( ) Lung carcinoma ( ) Lung neoplasm ( ) Malignant soft tissue neoplasm ( ) Melanoma ( ) Mesothelioma ( ) Myeloid leukaemia ( ) Neoplasm of esophagus ( ) Neuroblastoma ( ) Non-small-cell lung cancer ( ) Plasma cell myeloma ( ) Prostate cancer ( ) Prostate carcinoma ( ) Prostate neoplasm ( ) Sarcoma ( ) Squamous cell carcinoma ( ) Testicular cancer ( ) Transitional cell carcinoma ( ) Acute myelogenous leukaemia ( ) Bone osteosarcoma ( ) Carcinoma ( ) Gastric cancer ( ) Lung adenocarcinoma ( ) Lung cancer ( ) Osteosarcoma ( ) Stomach cancer ( ) Colorectal carcinoma ( ) Metastatic malignant neoplasm ( ) Myelodysplastic syndrome ( ) Ovarian neoplasm ( )
UniProt ID	CTG1B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1S9W; 2BNQ; 2BNR; 2F53; 2F54; 2P5E; 2P5W; 2PYE; 3GJF; 3HAE; 3KLA; 6AT5; 6AVF; 6AVG; 6RP9; 6RPA; 6RPB
Pfam ID	PF09341
Sequence	MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Tissue Specificity	Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Meningioma	DISPT4TG	Definitive	Altered Expression	[1]
Ovarian cancer	DISZJHAP	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[5]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[5]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[6]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[2]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[7]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[3]
Glioma	DIS5RPEH	Strong	Altered Expression	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[11]
Liposarcoma	DIS8IZVM	Strong	Altered Expression	[12]
Lung carcinoma	DISTR26C	Strong	Biomarker	[13]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[14]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[15]
Melanoma	DIS1RRCY	Strong	Altered Expression	[16]
Mesothelioma	DISKWK9M	Strong	Posttranslational Modification	[17]
Myeloid leukaemia	DISMN944	Strong	Altered Expression	[18]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[7]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[20]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[22]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[22]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[23]
Sarcoma	DISZDG3U	Strong	Biomarker	[15]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[24]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[25]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[26]
Acute myelogenous leukaemia	DISCSPTN	moderate	Biomarker	[27]
Bone osteosarcoma	DIST1004	moderate	Biomarker	[28]
Carcinoma	DISH9F1N	moderate	Altered Expression	[29]
Gastric cancer	DISXGOUK	moderate	Biomarker	[30]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[31]
Lung cancer	DISCM4YA	moderate	Biomarker	[13]
Osteosarcoma	DISLQ7E2	moderate	Biomarker	[28]
Stomach cancer	DISKIJSX	moderate	Biomarker	[30]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[32]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[33]
Myelodysplastic syndrome	DISYHNUI	Limited	Biomarker	[34]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[35]
------------------------------------------------------------------------------------


⏷ Show the Full List of 45 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cancer/testis antigen 1 (CTAG1B).	[36]
------------------------------------------------------------------------------------

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cancer/testis antigen 1 (CTAG1B).	[37]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Cancer/testis antigen 1 (CTAG1B).	[38]
Aripiprazole	DM3NUMH	Approved	Aripiprazole increases the expression of Cancer/testis antigen 1 (CTAG1B).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cancer/testis antigen 1 (CTAG1B).	[40]
------------------------------------------------------------------------------------

References

1	NY-ESO-1 expression in meningioma suggests a rationale for new immunotherapeutic approaches.Cancer Immunol Res. 2013 Nov;1(5):296-302. doi: 10.1158/2326-6066.CIR-13-0029. Epub 2013 Aug 5.
2	NY-ESO-1 expression predicts an aggressive phenotype of ovarian cancer.Gynecol Oncol. 2017 Jun;145(3):420-425. doi: 10.1016/j.ygyno.2017.03.509. Epub 2017 Apr 6.
3	Current Trends in Clinical Development of Gene and Cellular Therapeutic Products for Cancer in Japan.Clin Ther. 2019 Jan;41(1):174-184.e3. doi: 10.1016/j.clinthera.2018.11.003. Epub 2018 Dec 7.
4	Prevalence of plasma autoantibody against cancer testis antigen NY-ESO-1 in HTLV-1 infected individuals with different clinical status.Virol J. 2017 Jul 17;14(1):130. doi: 10.1186/s12985-017-0802-9.
5	Association of rs2234693 and rs9340799 polymorphisms of ESR1 gene in breast cancer of Mexican population.J BUON. 2019 Sep-Oct;24(5):1927-1933.
6	Expression of MAGE-A and NY-ESO-1 cancer/testis antigens is enriched in triple-negative invasive breast cancers.Histopathology. 2018 Jul;73(1):68-80. doi: 10.1111/his.13498. Epub 2018 Apr 14.
7	Heterogeneous expression of GAGE, NY-ESO-1, MAGE-A and SSX proteins in esophageal cancer: Implications for immunotherapy.Int J Cancer. 2006 Jan 1;118(1):123-8. doi: 10.1002/ijc.21219.
8	Expression and clinical significance of cancer-testis genes in clear cell renal cell carcinoma.Int J Clin Exp Pathol. 2014 Jun 15;7(7):4112-9. eCollection 2014.
9	Linkage between EMT and stemness state through molecular association between TWIST1 and NY-ESO1 in esophageal squamouscell carcinoma.Biochimie. 2019 Aug;163:84-93. doi: 10.1016/j.biochi.2019.05.016. Epub 2019 May 31.
10	NY-ESO-1- and survivin-specific T-cell responses in the peripheral blood from patients with glioma.Cancer Immunol Immunother. 2018 Feb;67(2):237-246. doi: 10.1007/s00262-017-2066-z. Epub 2017 Oct 20.
11	Potential therapeutic value of dendritic cells loaded with NYESO? protein for the immunotherapy of advanced hepatocellular carcinoma.Int J Mol Med. 2013 Dec;32(6):1366-72. doi: 10.3892/ijmm.2013.1510. Epub 2013 Sep 27.
12	Comprehensive adipocytic and neurogenic tissue microarray analysis of NY-ESO-1 expression - a promising immunotherapy target in malignant peripheral nerve sheath tumor and liposarcoma.Oncotarget. 2016 Nov 8;7(45):72860-72867. doi: 10.18632/oncotarget.12096.
13	Case-Control Study: Smoking History Affects the Production of Tumor Antigen-Specific Antibodies NY-ESO-1 in Patients with Lung Cancer in Comparison with Cancer Disease-Free Group.J Thorac Oncol. 2017 Feb;12(2):249-257. doi: 10.1016/j.jtho.2016.09.136. Epub 2016 Oct 25.
14	Immunohystochemical expression of cancer/testis antigens (MAGE-A3/4, NY-ESO-1) in non-small cell lung cancer: the relationship with clinical-pathological features.Coll Antropol. 2008 Sep;32(3):731-6.
15	A Pilot Trial of the Combination of Transgenic NY-ESO-1-reactive Adoptive Cellular Therapy with Dendritic Cell Vaccination with or without Ipilimumab.Clin Cancer Res. 2019 Apr 1;25(7):2096-2108. doi: 10.1158/1078-0432.CCR-18-3496. Epub 2018 Dec 20.
16	The programmed cell death protein-1/programmed cell death ligand 1 expression, CD3+ T cell infiltration, NY-ESO-1 expression, and microsatellite instability phenotype in primary cutaneous melanoma and mucosal melanoma and their clinical significance and prognostic value: a study of 89 consecutive cases.Melanoma Res. 2020 Feb;30(1):85-101. doi: 10.1097/CMR.0000000000000620.
17	HDAC1-mSin3a-NCOR1, Dnmt3b-HDAC1-Egr1 and Dnmt1-PCNA-UHRF1-G9a regulate the NY-ESO1 gene expression.Mol Oncol. 2013 Jun;7(3):452-63. doi: 10.1016/j.molonc.2012.11.004. Epub 2012 Dec 21.
18	The DNA demethylating agent 5-aza-2'-deoxycytidine induces expression of NY-ESO-1 and other cancer/testis antigens in myeloid leukemia cells. Leuk Res. 2010 Jul;34(7):899-905. doi: 10.1016/j.leukres.2010.02.004. Epub 2010 Apr 10.
19	Immune landscape and in vivo immunogenicity of NY-ESO-1 tumor antigen in advanced neuroblastoma patients.BMC Cancer. 2018 Oct 16;18(1):983. doi: 10.1186/s12885-018-4910-8.
20	Phase Ib evaluation of a self-adjuvanted protamine formulated mRNA-based active cancer immunotherapy, BI1361849 (CV9202), combined with local radiation treatment in patients with stage IV non-small cell lung cancer.J Immunother Cancer. 2019 Feb 8;7(1):38. doi: 10.1186/s40425-019-0520-5.
21	Decreasing New York esophageal squamous cell carcinoma 1 expression inhibits multiple myeloma growth and osteolytic lesions.J Cell Physiol. 2020 Mar;235(3):2183-2194. doi: 10.1002/jcp.29128. Epub 2019 Sep 5.
22	Combination of Prostate Cancer Antigen 3 and Prostate-Specific Antigen Improves Diagnostic Accuracy in Men at Risk of Prostate Cancer.Arch Pathol Lab Med. 2018 Sep;142(9):1106-1112. doi: 10.5858/arpa.2017-0185-OA. Epub 2018 Mar 16.
23	Immunohistochemical expression of tumor antigens MAGE-A1, MAGE-A3/4, and NY-ESO-1 in cancerous and benign prostatic tissue.Prostate. 2006 Jan 1;66(1):13-8. doi: 10.1002/pros.20312.
24	NY-ESO-1 antigen expression and immune response are associated with poor prognosis in MAGE-A4-vaccinated patients with esophageal or head/neck squamous cell carcinoma.Oncotarget. 2018 Nov 13;9(89):35997-36011. doi: 10.18632/oncotarget.26323. eCollection 2018 Nov 13.
25	Immunohistochemical expression and clinicopathological assessment of the cancer testis antigens NY-ESO-1 and MAGE-A4 in high-grade soft-tissue sarcoma.Oncol Lett. 2019 Apr;17(4):3937-3943. doi: 10.3892/ol.2019.10044. Epub 2019 Feb 14.
26	Expression of MAGE-A3, NY-ESO-1, LAGE-1 and PRAME in urothelial carcinoma.Br J Cancer. 2012 Jun 26;107(1):116-22. doi: 10.1038/bjc.2012.215. Epub 2012 May 17.
27	T cells targeting multiple tumor-associated antigens as a postremission treatment to prevent or delay relapse in acute myeloid leukemia.Cancer Manag Res. 2019 Jul 16;11:6467-6476. doi: 10.2147/CMAR.S205296. eCollection 2019.
28	Induction of a specific CD8+ T-cell response to cancer/testis antigens by demethylating pre-treatment against osteosarcoma.Oncotarget. 2014 Nov 15;5(21):10791-802. doi: 10.18632/oncotarget.2505.
29	Expression of cancer/testis antigens in salivary gland carcinomas with reference to MAGE-A and NY-ESO-1 expression in adenoid cystic carcinoma.Histopathology. 2017 Aug;71(2):305-315. doi: 10.1111/his.13226. Epub 2017 Jun 2.
30	Tumor antigen-specific CD8(+) T cells are negatively regulated by PD-1 and Tim-3 in human gastric cancer.Cell Immunol. 2017 Mar;313:43-51. doi: 10.1016/j.cellimm.2017.01.001. Epub 2017 Jan 5.
31	Treatment of metastatic non-small cell lung cancer with NY-ESO-1 specific TCR engineered-T cells in a phase I clinical trial: A case report.Oncol Lett. 2018 Dec;16(6):6998-7007. doi: 10.3892/ol.2018.9534. Epub 2018 Oct 1.
32	Expression and immunogenicity of NY-ESO-1 in colorectal cancer.Exp Ther Med. 2017 Jun;13(6):3581-3585. doi: 10.3892/etm.2017.4405. Epub 2017 Apr 28.
33	Immune targets and neoantigens for cancer immunotherapy and precision medicine.Cell Res. 2017 Jan;27(1):11-37. doi: 10.1038/cr.2016.155. Epub 2016 Dec 27.
34	NY-ESO-1 Vaccination in Combination with Decitabine Induces Antigen-Specific T-lymphocyte Responses in Patients with Myelodysplastic Syndrome.Clin Cancer Res. 2018 Mar 1;24(5):1019-1029. doi: 10.1158/1078-0432.CCR-17-1792. Epub 2017 Sep 25.
35	A rare population of tumor antigen-specific CD4(+)CD8(+) double-positive T lymphocytes uniquely provide CD8-independent TCR genes for engineering therapeutic T cells.J Immunother Cancer. 2019 Jan 9;7(1):7. doi: 10.1186/s40425-018-0467-y.
36	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
38	Synergistic induction of NY-ESO-1 antigen expression by a novel histone deacetylase inhibitor, valproic acid, with 5-aza-2'-deoxycytidine in glioma cells. J Neurooncol. 2009 Mar;92(1):15-22. doi: 10.1007/s11060-008-9732-0. Epub 2008 Nov 22.
39	Small Molecule Antipsychotic Aripiprazole Potentiates Ozone-Induced Inflammation in Airway Epithelium. Chem Res Toxicol. 2019 Oct 21;32(10):1997-2005. doi: 10.1021/acs.chemrestox.9b00149. Epub 2019 Sep 11.
40	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.