Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK1JVAH)

DOT Name Multicilin (MCIDAS)
Synonyms Multiciliate differentiation and DNA synthesis-associated cell cycle protein; McIdas protein; Protein Idas
Gene Name MCIDAS
Related Disease
Ciliary dyskinesia, primary, 42 ( )
Cognitive impairment ( )
High blood pressure ( )
Southeast Asian ovalocytosis ( )
Advanced cancer ( )
Amyloidosis ( )
Anxiety disorder ( )
Cardiac failure ( )
Chronic kidney disease ( )
Ciliopathy ( )
Congestive heart failure ( )
Depression ( )
Frontotemporal dementia ( )
Hemochromatosis ( )
Huntington disease ( )
Matthew-Wood syndrome ( )
Mental disorder ( )
Mixed anxiety and depressive disorder ( )
Mood disorder ( )
Nail-patella syndrome ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Obstructive sleep apnea ( )
Orthostatic hypotension ( )
Pancreatic cancer ( )
Parkinson disease ( )
Primary ciliary dyskinesia 1 ( )
Progressive supranuclear palsy ( )
Vascular dementia ( )
Chronic renal failure ( )
Plasma cell myeloma ( )
Primary ciliary dyskinesia ( )
Cerebrovascular disease ( )
Coronary heart disease ( )
Amyotrophic lateral sclerosis ( )
Anxiety ( )
Granular corneal dystrophy type II ( )
Post-traumatic stress disorder ( )
Stroke ( )
UniProt ID
MCIN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4BRY
Pfam ID
PF07412
Sequence
MQACGGGAAGRRAFDSICPNRMLALPGRALLCKPGKPERKFAPPRKFFPGCTGGSPVSVY
EDPPDAEPTALPALTTIDLQDLADCSSLLGSDAPPGGDLAASQNHSHQTEADFNLQDFRD
TVDDLISDSSSMMSPTLASGDFPFSPCDISPFGPCLSPPLDPRALQSPPLRPPDVPPPEQ
YWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDK
LMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEVDAILREISERCDEALQSRDP
KRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRT
LAFPQGNAFTIRTANGGYKFRWVPS
Function
Transcription regulator specifically required for multiciliate cell differentiation. Acts in a multiprotein complex containing E2F4 and E2F5 that binds and activates genes required for centriole biogenesis. Required for the deuterosome-mediated acentriolar pathway. Plays a role in mitotic cell cycle progression by promoting cell cycle exit. Modulates GMNN activity by reducing its affinity for CDT1.

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Ciliary dyskinesia, primary, 42 DIS2U5UK Definitive Autosomal recessive [1]
Cognitive impairment DISH2ERD Definitive Biomarker [2]
High blood pressure DISY2OHH Definitive Biomarker [3]
Southeast Asian ovalocytosis DISSANVQ Definitive Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Genetic Variation [4]
Amyloidosis DISHTAI2 Strong Biomarker [5]
Anxiety disorder DISBI2BT Strong Biomarker [6]
Cardiac failure DISDC067 Strong Biomarker [7]
Chronic kidney disease DISW82R7 Strong Biomarker [8]
Ciliopathy DIS10G4I Strong Altered Expression [9]
Congestive heart failure DIS32MEA Strong Biomarker [7]
Depression DIS3XJ69 Strong Biomarker [10]
Frontotemporal dementia DISKYHXL Strong Biomarker [11]
Hemochromatosis DISAPY0H Strong Genetic Variation [12]
Huntington disease DISQPLA4 Strong Biomarker [13]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [14]
Mental disorder DIS3J5R8 Strong Biomarker [15]
Mixed anxiety and depressive disorder DISV809X Strong Genetic Variation [16]
Mood disorder DISLVMWO Strong Biomarker [17]
Nail-patella syndrome DIS8C4CT Strong Biomarker [18]
Neoplasm DISZKGEW Strong Genetic Variation [19]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [20]
Obesity DIS47Y1K Strong Genetic Variation [21]
Obstructive sleep apnea DIS0SVD1 Strong Genetic Variation [21]
Orthostatic hypotension DISBKQGT Strong Biomarker [22]
Pancreatic cancer DISJC981 Strong Altered Expression [14]
Parkinson disease DISQVHKL Strong Biomarker [23]
Primary ciliary dyskinesia 1 DISPGX6H Strong GermlineCausalMutation [24]
Progressive supranuclear palsy DISO5KRQ Strong Biomarker [25]
Vascular dementia DISVO82H Strong Biomarker [26]
Chronic renal failure DISGG7K6 moderate Biomarker [27]
Plasma cell myeloma DIS0DFZ0 moderate Biomarker [28]
Primary ciliary dyskinesia DISOBC7V Supportive Autosomal dominant [24]
Cerebrovascular disease DISAB237 Disputed Biomarker [29]
Coronary heart disease DIS5OIP1 Disputed Biomarker [29]
Amyotrophic lateral sclerosis DISF7HVM Limited Biomarker [30]
Anxiety DISIJDBA Limited Biomarker [6]
Granular corneal dystrophy type II DISAEE20 Limited Biomarker [31]
Post-traumatic stress disorder DISHL1EY Limited Biomarker [32]
Stroke DISX6UHX Limited Biomarker [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 40 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Multicilin (MCIDAS). [34]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Multicilin (MCIDAS). [35]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Multicilin (MCIDAS). [36]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Neuropsychological correlates of instrumental activities of daily living in neurocognitive disorders: a possible role for executive dysfunction and mood changes.Int Psychogeriatr. 2018 Dec;30(12):1871-1881. doi: 10.1017/S1041610218000455. Epub 2018 May 23.
3 Influence of glucose metabolism on cognitive function of patients with acute small-artery occlusion.J Biol Regul Homeost Agents. 2017 Jul-Sep;31(3):717-724.
4 Mindfulness and Meditative Movement Interventions for Men Living With Cancer: A Meta-analysis.Ann Behav Med. 2020 Apr 20;54(5):360-373. doi: 10.1093/abm/kaz053.
5 Characteristic Biomarker and Cognitive Profile in Incipient Mixed Dementia.J Alzheimers Dis. 2020;73(2):597-607. doi: 10.3233/JAD-190651.
6 Association of anxiety with subcortical amyloidosis in cognitively normal older adults.Mol Psychiatry. 2020 Oct;25(10):2599-2607. doi: 10.1038/s41380-018-0214-2. Epub 2018 Aug 16.
7 Heart Failure and Cognitive Impairment in the Atherosclerosis Risk in Communities (ARIC) Study.J Gen Intern Med. 2018 Oct;33(10):1721-1728. doi: 10.1007/s11606-018-4556-x. Epub 2018 Jul 20.
8 Different Abnormalities of Cortical Neural Synchronization Mechanisms in Patients with Mild Cognitive Impairment due to Alzheimer's and Chronic Kidney Diseases: An EEG Study.J Alzheimers Dis. 2018;65(3):897-915. doi: 10.3233/JAD-180245.
9 TRRAP is a central regulator of human multiciliated cell formation.J Cell Biol. 2018 Jun 4;217(6):1941-1955. doi: 10.1083/jcb.201706106. Epub 2018 Mar 27.
10 Depression, subjective cognitive decline, and the risk of neurocognitive disorders.Alzheimers Res Ther. 2019 Aug 9;11(1):70. doi: 10.1186/s13195-019-0527-7.
11 CSF placental growth factor - a novel candidate biomarker of frontotemporal dementia.Ann Clin Transl Neurol. 2019 Mar 29;6(5):863-872. doi: 10.1002/acn3.763. eCollection 2019 May.
12 Evaluation of HFE (hemochromatosis) mutations as genetic modifiers in sporadic AD and MCI.Neurobiol Aging. 2004 Apr;25(4):465-74. doi: 10.1016/j.neurobiolaging.2003.06.008.
13 Mild cognitive impairment and dementia in motor manifest Huntington's disease: Classification and prevalence.J Neurol Sci. 2020 Jan 15;408:116523. doi: 10.1016/j.jns.2019.116523. Epub 2019 Oct 15.
14 Pharmacological inhibition of ABCC3 slows tumour progression in animal models of pancreatic cancer.J Exp Clin Cancer Res. 2019 Aug 5;38(1):312. doi: 10.1186/s13046-019-1308-7.
15 The AD8 (Dementia Screening Interview) is a valid and reliable screening scale not only for dementia but also for mild cognitive impairment in the Turkish geriatric outpatients.Int Psychogeriatr. 2019 Feb;31(2):223-229. doi: 10.1017/S1041610218000674. Epub 2018 Jun 20.
16 Mild cognitive impairment in Parkinson's disease: a distinct clinical entity?.Transl Neurodegener. 2017 Sep 13;6:24. doi: 10.1186/s40035-017-0094-4. eCollection 2017.
17 Altered Intrinsic Coupling between Functional Connectivity Density and Amplitude of Low-Frequency Fluctuation in Mild Cognitive Impairment with Depressive Symptoms.Neural Plast. 2018 May 29;2018:1672708. doi: 10.1155/2018/1672708. eCollection 2018.
18 Neuropsychiatric symptoms as predictors of conversion from MCI to dementia: a machine learning approach.Int Psychogeriatr. 2020 Mar;32(3):381-392. doi: 10.1017/S1041610219001030.
19 Hyper-Methylated Loci Persisting from Sessile Serrated Polyps to Serrated Cancers.Int J Mol Sci. 2017 Mar 2;18(3):535. doi: 10.3390/ijms18030535.
20 Non-pharmacological interventions for cognition in patients with Type 2 diabetes mellitus: a systematic review.QJM. 2020 Mar 1;113(3):155-161. doi: 10.1093/qjmed/hcz053.
21 Obesity and Co-morbid Conditions Are Associated with Specific Neuropsychiatric Symptoms in Mild Cognitive Impairment.Front Aging Neurosci. 2017 May 29;9:164. doi: 10.3389/fnagi.2017.00164. eCollection 2017.
22 Dementia Predictors in Parkinson Disease: A Validation Study.J Parkinsons Dis. 2017;7(1):159-162. doi: 10.3233/JPD-160925.
23 Incidence of Mild Cognitive Impairment and Dementia in Parkinson's Disease: The Parkinson's Disease Cognitive Impairment Study.Front Aging Neurosci. 2019 Feb 8;11:21. doi: 10.3389/fnagi.2019.00021. eCollection 2019.
24 MCIDAS mutations result in a mucociliary clearance disorder with reduced generation of multiple motile cilia. Nat Commun. 2014 Jul 22;5:4418. doi: 10.1038/ncomms5418.
25 Mild Cognitive Impairment and Progression to Dementia in Progressive Supranuclear Palsy.Neurodegener Dis. 2017;17(6):286-291. doi: 10.1159/000479110. Epub 2017 Sep 8.
26 Biomarker-Based Prediction of Progression to Dementia: F-18 FDG-PET in Amnestic MCI.Neurol India. 2019 Sep-Oct;67(5):1310-1317. doi: 10.4103/0028-3886.271245.
27 Analysis of mandibular changes using panoramic-based indices in patients with chronic renal failure.Int J Artif Organs. 2017 Sep 29:0. doi: 10.5301/ijao.5000649. Online ahead of print.
28 Management of Newly Diagnosed Elderly Multiple Myeloma Patients.Curr Oncol Rep. 2019 May 24;21(7):64. doi: 10.1007/s11912-019-0804-4.
29 Metabolic syndrome, hypertension, and nervous system injury: Epidemiological correlates.Clin Exp Hypertens. 2017;39(1):8-16. doi: 10.1080/10641963.2016.1210629. Epub 2017 Jan 10.
30 Open-label 24-week extension study of edaravone (MCI-186) in amyotrophic lateral sclerosis.Amyotroph Lateral Scler Frontotemporal Degener. 2017 Oct;18(sup1):55-63. doi: 10.1080/21678421.2017.1364269.
31 Isothiazolinone derivatives and allergic contact dermatitis: a review and update.J Eur Acad Dermatol Venereol. 2019 Feb;33(2):267-276. doi: 10.1111/jdv.15267.
32 Sports psychiatry: mental health and mental disorders in athletes and exercise treatment of mental disorders.Eur Arch Psychiatry Clin Neurosci. 2019 Aug;269(5):485-498. doi: 10.1007/s00406-018-0891-5. Epub 2018 Mar 21.
33 Post-stroke cognitive impairment - A cross-sectional comparison study between mild cognitive impairment of vascular and non-vascular etiology.J Neurol Sci. 2017 Jan 15;372:356-362. doi: 10.1016/j.jns.2016.10.031. Epub 2016 Oct 24.
34 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
35 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
36 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.