Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKFNDUI)

• DOT Name: Myelin protein zero-like protein 2 (MPZL2)
• Synonyms: Epithelial V-like antigen 1
• Gene Name: MPZL2
• Related Disease:
  Arteriosclerosis
  Atherosclerosis
  Brain infarction
  Hearing loss, autosomal recessive 111
  Myocardial infarction
  Alopecia
  Breast cancer
  Breast carcinoma
  Carotid stenosis
  Dementia
  Ear malformation
  Gonorrhea
  Nonsyndromic genetic hearing loss
  Paraganglioma
  Pheochromocytoma
  Retinoblastoma
  Adult glioblastoma
  Coronary atherosclerosis
  Coronary heart disease
  Glioblastoma multiforme
  Hearing loss, autosomal recessive
  Goiter
  Hypothyroidism
  Lung adenocarcinoma
  Lung carcinoma
  Pendred syndrome
  Sensorineural hearing loss disorder
• UniProt ID: MPZL2_HUMAN
• Pfam ID: PF07686
• Sequence:
  MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALT
  VTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGT
  YTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRK
  KRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
• Function: Mediates homophilic cell-cell adhesion.
• Tissue Specificity: Widely expressed. In fetal tissues, highest expression in the inner ear. In adult tissues, highest levels in thymus and lung.

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arteriosclerosis	DISK5QGC	Definitive	Genetic Variation	[1]
Atherosclerosis	DISMN9J3	Definitive	Genetic Variation	[1]
Brain infarction	DISPPGYK	Definitive	Genetic Variation	[1]
Hearing loss, autosomal recessive 111	DISKNW8N	Definitive	Autosomal recessive	[2]
Myocardial infarction	DIS655KI	Definitive	Genetic Variation	[1]
Alopecia	DIS37HU4	Strong	Genetic Variation	[3]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[4]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[4]
Carotid stenosis	DISZA8D0	Strong	Biomarker	[5]
Dementia	DISXL1WY	Strong	Genetic Variation	[6]
Ear malformation	DISVJGPS	Strong	Biomarker	[7]
Gonorrhea	DISQ5AO6	Strong	Biomarker	[8]
Nonsyndromic genetic hearing loss	DISZX61P	Strong	Autosomal recessive	[9]
Paraganglioma	DIS2XXH5	Strong	Genetic Variation	[10]
Pheochromocytoma	DIS56IFV	Strong	Genetic Variation	[11]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[12]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[13]
Coronary atherosclerosis	DISKNDYU	moderate	Genetic Variation	[14]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[14]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[13]
Hearing loss, autosomal recessive	DIS8G9R9	Supportive	Autosomal recessive	[15]
Goiter	DISLCGI6	Limited	Biomarker	[16]
Hypothyroidism	DISR0H6D	Limited	Biomarker	[16]
Lung adenocarcinoma	DISD51WR	Limited	Genetic Variation	[17]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[17]
Pendred syndrome	DISZ1MU8	Limited	Biomarker	[16]
Sensorineural hearing loss disorder	DISJV45Z	Limited	Biomarker	[18]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Myelin protein zero-like protein 2 (MPZL2) affects the response to substance of Topotecan.	[36]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[19]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[20]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Myelin protein zero-like protein 2 (MPZL2).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Myelin protein zero-like protein 2 (MPZL2).	[24]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Myelin protein zero-like protein 2 (MPZL2).	[24]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Myelin protein zero-like protein 2 (MPZL2).	[25]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[26]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[27]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[28]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[30]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Myelin protein zero-like protein 2 (MPZL2).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Myelin protein zero-like protein 2 (MPZL2).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Myelin protein zero-like protein 2 (MPZL2).	[33]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[34]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Myelin protein zero-like protein 2 (MPZL2).	[35]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Myelin protein zero-like protein 2 (MPZL2).	[29]

References

• [1] Polymorphism R92Q of the tumour necrosis factor receptor 1 gene is associated with myocardial infarction and carotid intima-media thickness--the ECTIM, AXA, EVA and GENIC Studies.Eur J Hum Genet. 2004 Mar;12(3):213-9. doi: 10.1038/sj.ejhg.5201143.
• [2] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [3] The human orthologue of murine Mpzl3 with predicted adhesive and immune functions is a potential candidate gene for immune-related hereditary hair loss.Exp Dermatol. 2009 Mar;18(3):261-3. doi: 10.1111/j.1600-0625.2008.00797.x. Epub 2008 Oct 22.
• [4] Prospective multicenter cohort study to refine management recommendations for women at elevated familial risk of breast cancer: the EVA trial.J Clin Oncol. 2010 Mar 20;28(9):1450-7. doi: 10.1200/JCO.2009.23.0839. Epub 2010 Feb 22.
• [5] Safety of Carotid Revascularization in Patients With a History of Coronary Heart Disease.Stroke. 2019 Feb;50(2):413-418. doi: 10.1161/STROKEAHA.118.023085.
• [6] Risk of dementia in parents of probands with and without the apolipoprotein E4 allele. The EVA study.J Epidemiol Community Health. 1999 Jul;53(7):393-8. doi: 10.1136/jech.53.7.393.
• [7] Extremely discrepant mutation spectrum of SLC26A4 between Chinese patients with isolated Mondini deformity and enlarged vestibular aqueduct.J Transl Med. 2011 Sep 30;9:167. doi: 10.1186/1479-5876-9-167.
• [8] Il n'y a pas d'amour heureux pour Casanova: Chemical- and bio-analysis of his Memoirs.Electrophoresis. 2019 Dec;40(23-24):3050-3056. doi: 10.1002/elps.201800505. Epub 2019 Apr 15.
• [9] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [10] The value of a rapid contrast-enhanced angio-MRI protocol in the detection of head and neck paragangliomas in SDHx mutations carriers: a retrospective study on behalf of the PGL.EVA investigators.Eur Radiol. 2016 Jun;26(6):1696-704. doi: 10.1007/s00330-015-4024-5. Epub 2015 Oct 1.
• [11] Imaging work-up for screening of paraganglioma and pheochromocytoma in SDHx mutation carriers: a multicenter prospective study from the PGL.EVA Investigators.J Clin Endocrinol Metab. 2013 Jan;98(1):E162-73. doi: 10.1210/jc.2012-2975. Epub 2012 Nov 15.
• [12] Neuromechanical adaptations to slippery sport shoes.Hum Mov Sci. 2018 Jun;59:212-222. doi: 10.1016/j.humov.2018.04.016. Epub 2018 May 4.
• [13] Eva1 Maintains the Stem-like Character of Glioblastoma-Initiating Cells by Activating the Noncanonical NF-B Signaling Pathway.Cancer Res. 2016 Jan 1;76(1):171-81. doi: 10.1158/0008-5472.CAN-15-0884. Epub 2015 Dec 17.
• [14] Differential association of common carotid intima-media thickness and carotid atherosclerotic plaques with parental history of premature death from coronary heart disease : the EVA study.Arterioscler Thromb Vasc Biol. 1999 Feb;19(2):366-71. doi: 10.1161/01.atv.19.2.366.
• [15] MPZL2, Encoding the Epithelial Junctional Protein Myelin Protein Zero-like 2, Is Essential for Hearing in Man and Mouse. Am J Hum Genet. 2018 Jul 5;103(1):74-88. doi: 10.1016/j.ajhg.2018.05.011. Epub 2018 Jun 28.
• [16] Analysis of the thyroid phenotype in 42 patients with Pendred syndrome and nonsyndromic enlargement of the vestibular aqueduct.Thyroid. 2014 Apr;24(4):639-48. doi: 10.1089/thy.2013.0164. Epub 2014 Jan 20.
• [17] Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
• [18] Application of multiplanar reconstruction of spiral CT in the diagnosis and treatment of enlarged vestibular aqueducts.Acta Otolaryngol. 2019 Aug;139(8):665-670. doi: 10.1080/00016489.2019.1612534. Epub 2019 May 24.
• [19] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [20] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [21] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [22] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [25] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [26] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [27] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [28] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [29] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [30] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [31] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [32] Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
• [33] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [34] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [35] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [36] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.