Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLMCUIB)

• DOT Name: Nuclear factor 1 C-type (NFIC)
• Synonyms: NF1-C; Nuclear factor 1/C; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/C; NF-I/C; NFI-C; TGGCA-binding protein
• Gene Name: NFIC
• Related Disease:
  Chronic renal failure
  Cutaneous melanoma
  Ependymoma
  Intellectual disability
  Marshall-Smith syndrome
  Sotos syndrome
  Advanced cancer
  Amyloidosis
  Autism
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Dementia
  Diabetic kidney disease
  Gastric cancer
  Herpes simplex infection
  Microphthalmia, syndromic 2
  Neoplasm
  Neurofibromatosis
  Neurofibromatosis type 1
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate neoplasm
  Renal cell carcinoma
  Schwannomatosis
  Systemic sclerosis
  Neuroblastoma
  Alzheimer disease
  Bone osteosarcoma
  Epithelial ovarian cancer
  Neurodevelopmental disorder
  Osteosarcoma
  Severe acute respiratory syndrome (SARS)
• UniProt ID: NFIC_HUMAN
• Pfam ID: PF00859 ; PF03165 ; PF10524
• Sequence:
  MYSSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE
  LLGEKPEVKQKWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDC
  LRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYL
  AYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVV
  TGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYY
  TSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVH
  SGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQ
  PGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPD
  TSPANRSFVGLGPRDPAGIYQAQSWYLG
• Function: Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
• Reactome Pathway:
  RNA Polymerase III Abortive And Retractive Initiation (R-HSA-749476)
  RNA Polymerase III Transcription Termination (R-HSA-73980)

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic renal failure	DISGG7K6	Definitive	Genetic Variation	[1]
Cutaneous melanoma	DIS3MMH9	Definitive	Genetic Variation	[2]
Ependymoma	DISUMRNZ	Definitive	Biomarker	[3]
Intellectual disability	DISMBNXP	Definitive	Genetic Variation	[4]
Marshall-Smith syndrome	DIS8BYL7	Definitive	Genetic Variation	[5]
Sotos syndrome	DISN4U1D	Definitive	Genetic Variation	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Amyloidosis	DISHTAI2	Strong	Biomarker	[7]
Autism	DISV4V1Z	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[11]
Dementia	DISXL1WY	Strong	Biomarker	[12]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[13]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[14]
Herpes simplex infection	DISL1SAV	Strong	Altered Expression	[15]
Microphthalmia, syndromic 2	DIS1D0YQ	Strong	Altered Expression	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Neurofibromatosis	DIS5N2R6	Strong	Biomarker	[17]
Neurofibromatosis type 1	DIS53JH9	Strong	Biomarker	[17]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Altered Expression	[18]
Prostate cancer	DISF190Y	Strong	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[19]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[11]
Schwannomatosis	DISDWAM1	Strong	Biomarker	[20]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[21]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[22]
Alzheimer disease	DISF8S70	Limited	Genetic Variation	[23]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[24]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[25]
Neurodevelopmental disorder	DIS372XH	Limited	Biomarker	[26]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[24]
Severe acute respiratory syndrome (SARS)	DISYW14W	Limited	Genetic Variation	[27]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nuclear factor 1 C-type (NFIC).	[28]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Nuclear factor 1 C-type (NFIC).	[34]
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of Nuclear factor 1 C-type (NFIC).	[35]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Nuclear factor 1 C-type (NFIC).	[46]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Nuclear factor 1 C-type (NFIC).	[35]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Nuclear factor 1 C-type (NFIC).	[35]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nuclear factor 1 C-type (NFIC).	[29]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nuclear factor 1 C-type (NFIC).	[30]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nuclear factor 1 C-type (NFIC).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Nuclear factor 1 C-type (NFIC).	[32]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Nuclear factor 1 C-type (NFIC).	[33]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Nuclear factor 1 C-type (NFIC).	[36]
Marinol	DM70IK5	Approved	Marinol increases the expression of Nuclear factor 1 C-type (NFIC).	[37]
Selenium	DM25CGV	Approved	Selenium increases the expression of Nuclear factor 1 C-type (NFIC).	[38]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Nuclear factor 1 C-type (NFIC).	[39]
Panobinostat	DM58WKG	Approved	Panobinostat affects the expression of Nuclear factor 1 C-type (NFIC).	[40]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Nuclear factor 1 C-type (NFIC).	[41]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Nuclear factor 1 C-type (NFIC).	[42]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Nuclear factor 1 C-type (NFIC).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Nuclear factor 1 C-type (NFIC).	[44]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Nuclear factor 1 C-type (NFIC).	[45]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Nuclear factor 1 C-type (NFIC).	[47]
UNC0379	DMD1E4J	Preclinical	UNC0379 decreases the expression of Nuclear factor 1 C-type (NFIC).	[48]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Nuclear factor 1 C-type (NFIC).	[49]

References

• [1] Genetics of serum urate concentrations and gout in a high-risk population, patients with chronic kidney disease.Sci Rep. 2018 Sep 4;8(1):13184. doi: 10.1038/s41598-018-31282-z.
• [2] Novel pleiotropic risk loci for melanoma and nevus density implicate multiple biological pathways.Nat Commun. 2018 Nov 14;9(1):4774. doi: 10.1038/s41467-018-06649-5.
• [3] YAP1 subgroup supratentorial ependymoma requires TEAD and nuclear factor I-mediated transcriptional programmes for tumorigenesis.Nat Commun. 2019 Sep 2;10(1):3914. doi: 10.1038/s41467-019-11884-5.
• [4] Variants in nuclear factor I genes influence growth and development.Am J Med Genet C Semin Med Genet. 2019 Dec;181(4):611-626. doi: 10.1002/ajmg.c.31747. Epub 2019 Nov 15.
• [5] NFIX mutations affecting the DNA-binding domain cause a peculiar overgrowth syndrome (Malan syndrome): a new patients series.Eur J Med Genet. 2015 Sep;58(9):488-91. doi: 10.1016/j.ejmg.2015.06.009. Epub 2015 Jul 17.
• [6] The convergent roles of the nuclear factor I transcription factors in development and cancer.Cancer Lett. 2017 Dec 1;410:124-138. doi: 10.1016/j.canlet.2017.09.015. Epub 2017 Sep 28.
• [7] Age-Related Intraneuronal Aggregation of Amyloid- in Endosomes, Mitochondria, Autophagosomes, and Lysosomes.J Alzheimers Dis. 2020;73(1):229-246. doi: 10.3233/JAD-190835.
• [8] Correction: Educational delay and attainment in persons with neurofibromatosis 1 in Denmark.Eur J Hum Genet. 2019 Jun;27(6):994-996. doi: 10.1038/s41431-019-0378-5.
• [9] ATF-2 controls transcription of Maspin and GADD45 alpha genes independently from p53 to suppress mammary tumors.Oncogene. 2008 Feb 14;27(8):1045-54. doi: 10.1038/sj.onc.1210727. Epub 2007 Aug 13.
• [10] Forkhead Box F1 promotes breast cancer cell migration by upregulating lysyl oxidase and suppressing Smad2/3 signaling.BMC Cancer. 2016 Feb 23;16:142. doi: 10.1186/s12885-016-2196-2.
• [11] Analysis of the regulation of fatty acid binding protein 7 expression in human renal carcinoma cell lines.BMC Mol Biol. 2011 Jul 19;12:31. doi: 10.1186/1471-2199-12-31.
• [12] - but not -secretase proteolysis of APP causes synaptic and memory deficits in a mouse model of dementia.EMBO Mol Med. 2012 Mar;4(3):171-9. doi: 10.1002/emmm.201100195. Epub 2012 Jan 23.
• [13] Cell adhesion molecule-1 shedding induces apoptosis of renal epithelial cells and exacerbates human nephropathies.Am J Physiol Renal Physiol. 2018 Mar 1;314(3):F388-F398. doi: 10.1152/ajprenal.00385.2017. Epub 2017 Oct 25.
• [14] BCL6 degradation caused by the interaction with the C-terminus of pro-HB-EGF induces cyclin D2 expression in gastric cancers.Br J Cancer. 2009 Apr 21;100(8):1320-9. doi: 10.1038/sj.bjc.6605010. Epub 2009 Mar 31.
• [15] Two transcriptional activators, CCAAT-box-binding transcription factor and heat shock transcription factor, interact with a human hsp70 gene promoter.Mol Cell Biol. 1987 Mar;7(3):1129-38. doi: 10.1128/mcb.7.3.1129-1138.1987.
• [16] Nuclear import of transcriptional corepressor BCOR occurs through interaction with karyopherin expressed in human periodontal ligament.Biochem Biophys Res Commun. 2018 Dec 9;507(1-4):67-73. doi: 10.1016/j.bbrc.2018.10.158. Epub 2018 Nov 2.
• [17] Characterization and utilization of an international neurofibromatosis web-based, patient-entered registry: An observational study.PLoS One. 2017 Jun 23;12(6):e0178639. doi: 10.1371/journal.pone.0178639. eCollection 2017.
• [18] Increased cytochrome P450 17alpha-hydroxylase promoter function in theca cells isolated from patients with polycystic ovary syndrome involves nuclear factor-1. Mol Endocrinol. 2004 Mar;18(3):588-605.
• [19] Global analysis of differentially expressed genes in androgen-independent prostate cancer.Prostate Cancer Prostatic Dis. 2007;10(2):167-74. doi: 10.1038/sj.pcan.4500933. Epub 2007 Jan 2.
• [20] CTF meeting 2012: Translation of the basic understanding of the biology and genetics of NF1, NF2, and schwannomatosis toward the development of effective therapies.Am J Med Genet A. 2014 Mar;164A(3):563-78. doi: 10.1002/ajmg.a.36312. Epub 2014 Jan 17.
• [21] CCAAT binding transcription factor binds and regulates human COL1A1 promoter activity in human dermal fibroblasts: demonstration of increased binding in systemic sclerosis fibroblasts.Arthritis Rheum. 2000 Oct;43(10):2219-29. doi: 10.1002/1529-0131(200010)43:10<2219::AID-ANR9>3.0.CO;2-N.
• [22] Transcriptional modulation of monoaminergic neurotransmission genes by the histone deacetylase inhibitor trichostatin A in neuroblastoma cells. J Neural Transm (Vienna). 2012 Jan;119(1):17-24.
• [23] Transethnic genome-wide scan identifies novel Alzheimer's disease loci.Alzheimers Dement. 2017 Jul;13(7):727-738. doi: 10.1016/j.jalz.2016.12.012. Epub 2017 Feb 7.
• [24] MicroRNA-210 is increased and it is required for dedifferentiation of osteosarcoma cell line.Cell Biol Int. 2017 Mar;41(3):267-275. doi: 10.1002/cbin.10721. Epub 2017 Jan 6.
• [25] NF-YA underlies EZH2 upregulation and is essential for proliferation of human epithelial ovarian cancer cells.Mol Cancer Res. 2013 Apr;11(4):360-9. doi: 10.1158/1541-7786.MCR-12-0661. Epub 2013 Jan 29.
• [26] Chromatin Decondensation by FOXP2 Promotes Human Neuron Maturation and Expression of Neurodevelopmental Disease Genes.Cell Rep. 2019 May 7;27(6):1699-1711.e9. doi: 10.1016/j.celrep.2019.04.044.
• [27] Acquired but reversible loss of erythrocyte complement receptor 1 (CR1, CD35) and its longitudinal alteration in patients with severe acute respiratory syndrome.Clin Exp Immunol. 2005 Jan;139(1):112-9. doi: 10.1111/j.1365-2249.2005.02681.x.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [30] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [31] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [32] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [33] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [34] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [35] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [36] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [37] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [38] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [39] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [40] The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
• [41] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [42] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [43] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [44] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [45] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [46] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [49] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.