Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMCAXWR)

• DOT Name: Neurobeachin-like protein 2 (NBEAL2)
• Gene Name: NBEAL2
• Related Disease:
  Gray platelet syndrome
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Anxiety
  Anxiety disorder
  Arteriosclerosis
  Atherosclerosis
  Chronic kidney disease
  Colorectal carcinoma
  Congenital factor XIII deficiency
  Dementia
  Depression
  Disease of orbital part of eye adnexa
  High blood pressure
  Lupus
  Malaria
  Neoplasm
  Non-insulin dependent diabetes
  Obesity
  Pneumonia
  Pneumonia caused by gram negative bacteria
  Primary myelofibrosis
  Prostate cancer
  Prostate carcinoma
  Systemic lupus erythematosus
  Coagulation defect
  Myelofibrosis
  Nasopharyngeal carcinoma
  Niemann-Pick disease type C
  Colorectal adenocarcinoma
  Myotonic dystrophy type 1
  Schistosomiasis
  Thrombocytopenia
  Type-1/2 diabetes
• UniProt ID: NBEL2_HUMAN
• Pfam ID: PF02138 ; PF15787 ; PF16057 ; PF20426 ; PF20425 ; PF14844
• Sequence:
  MAASERLYELWLLYYAQKDLGYLQQWLKAFVGAFKKSISLSSLEPRRPEEAGAEVPLLPL
  DELHVLAEQLHQADLEQALLLLKLFIILCRNLENIEAGRGQVLVPRVLALLTKLVAELKG
  CPPPQGRGTQLENVALHALLLCEGLFDPYQTWRRQRSGEVISSKEKSKYKFPPAALPQEF
  SAFFQESLQNADHLPPILLLRLIHLFCAVLAGGKENGQMAVSDGSVKGLLSVVRGWSRGP
  APDPCLVPLALEALVGAVHVLHASRAPPRGPELRALLESYFHVLNADWPAGLSSGPEEAL
  VTLRVSMLDAIPMMLACEDRPVLQATFLSNNCFEHLTRLIQNSKLYLQSRAPPEGDSDLA
  TRLLTEPDVQKVLDQDTDAIAVHVVRVLTCIMSDSPSAKEVFKERIGYPHLQEVLQSHGP
  PTHRLLQELLNMAVEGDHSMCPPPPIRNEQPVLVLAQWLPSLPTAELRLFLAQRLRWLCD
  SCPASRATCVQAGLVGCLLETLSTGLALEARCQEQLLALLQALGRVSIRPMELRHLLRPR
  PGLDSEPGGAEAGKARHAGAVIRTLSGMARHQGPARALRYFDLTPSMAGIMVPPVQRWPG
  PGFTFHAWLCLHPMDTAPTPAPTRPLQRKQLYSFFTSSGSGFEAFFTAAGTLVVAVCTRK
  EYLTMSLPEVSFADSAWHCVAIVHVPGRRPFSQNLVHVYKDGHLVKTAPLRCPSLSEPFS
  SCCIGSAGYRTTTTTTGLPTPPVPATLAYTHPALTRSQSVPASTGLGWGSGLVAPLQEGS
  IDSTLAGTQDTRWGSPTSLEGELGAVAIFHEALQATALRTLCTLGPNETAPFKPEGELHE
  LSTRLLLHYSPQACKNNICLDLSPSHGLDGRLTGHRVETWDVKDVVNCVGGMGALLPLLE
  RVAAQPKEAEAGPAETHDLVGPELTSGHNTQGLVLPLGKSSEERMERNAVAAFLLMLRNF
  LQGHMVNQESLVQCQGPAIIGALLRKVPSWAMDMNVLMSAQLLMEQVAAEGSGPLLYLLY
  QHLLFNFHLWTLSDFAVRLGHIQYMSSIVREHRQKLRKKYGVQFILDALRTHYSPQRERP
  LAADDLRTVQTSLLGLAREFLVRSLSADDVQVTQTMLSFLAATGDDGQAVGALDLLLALL
  HGSLVQESLAVFLLEPGNLEVLLALLVRPGSLPLLPDRVCKILRRLQQNERLPERSRQRL
  RLRECGLQGLVACLPEGTVSPQLCQGLYKLFLGADCLNLSDLLAVVQLSLQADLSVRLDI
  CRQLFHLIYGQPDVVRLLARQAGWQDVLTRLYVLEAATAGSPPPSSPESPTSPKPAPPKP
  PTESPAEPSDVFLPSEAPCPDPDGFYHALSPFCTPFDLGLERSSVGSGNTAGGGGSSGTL
  TPASQPGTPSPLDGPRPFPAAPGRHSSSLSNVLEDGSLPEPTISGDDTSNTSNPQQTSEE
  ELCNLLTNVLFSVTWRGVEGSDEAAWRERGQVFSVLTQLGASATLVRPPDCIKRSLLEMM
  LESALTDIKEAPVGVLASLTQQALWLLRLLQDFLCAEGHGNQELWSEKLFEGVCSLLDRL
  GAWPHLANGTADLREMAQIGLRLVLGYILLEDPQLHAQAYVRLHMLLQTAVPARREEACY
  VLSKLEAALGRVLNTSSLESATDEAGSPLAAAAAAAAAERCSWLVPLVRTLLDRAYEPLG
  LQWGLPSLPPTNGSPTFFEDFQAFCATPEWRHFIDKQVQPTMSQFEMDTYAKSHDLMSGF
  WNACYDMLMSSGQRRQWERAQSRRAFQELVLEPAQRRARLEGLRYTAVLKQQATQHSMAL
  LHWGALWRQLASPCGAWALRDTPIPRWKLSSAETYSRMRLKLVPNHHFDPHLEASALRDN
  LGEVPLTPTEEASLPLAVTKEAKVSTPPELLQEDQLGEDELAELETPMEAAELDEQREKL
  VLSAECQLVTVVAVVPGLLEVTTQNVYFYDGSTERVETEEGIGYDFRRPLAQLREVHLRR
  FNLRRSALELFFIDQANYFLNFPCKVGTTPVSSPSQTPRPQPGPIPPHTQVRNQVYSWLL
  RLRPPSQGYLSSRSPQEMLRASGLTQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFP
  WVLQDYVSPTLDLSNPAVFRDLSKPIGVVNPKHAQLVREKYESFEDPAGTIDKFHYGTHY
  SNAAGVMHYLIRVEPFTSLHVQLQSGRFDCSDRQFHSVAAAWQARLESPADVKELIPEFF
  YFPDFLENQNGFDLGCLQLTNEKVGDVVLPPWASSPEDFIQQHRQALESEYVSAHLHEWI
  DLIFGYKQRGPAAEEALNVFYYCTYEGAVDLDHVTDERERKALEGIISNFGQTPCQLLKE
  PHPTRLSAEEAAHRLARLDTNSPSIFQHLDELKAFFAEVVSDGVPLVLALVPHRQPHSFI
  TQGSPDLLVTVSASGLLGTHSWLPYDRNISNYFSFSKDPTMGSHKTQRLLSGPWVPGSGV
  SGQALAVAPDGKLLFSGGHWDGSLRVTALPRGKLLSQLSCHLDVVTCLALDTCGIYLISG
  SRDTTCMVWRLLHQGGLSVGLAPKPVQVLYGHGAAVSCVAISTELDMAVSGSEDGTVIIH
  TVRRGQFVAALRPLGATFPGPIFHLALGSEGQIVVQSSAWERPGAQVTYSLHLYSVNGKL
  RASLPLAEQPTALTVTEDFVLLGTAQCALHILQLNTLLPAAPPLPMKVAIRSVAVTKERS
  HVLVGLEDGKLIVVVAGQPSEVRSSQFARKLWRSSRRISQVSSGETEYNPTEAR
• Function: Probably involved in thrombopoiesis. Plays a role in the development or secretion of alpha-granules, that contain several growth factors important for platelet biogenesis.
• Tissue Specificity: Expressed in megakaryocytes.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gray platelet syndrome	DISLOTCW	Definitive	Autosomal recessive	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Anxiety	DISIJDBA	Strong	Biomarker	[5]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Congenital factor XIII deficiency	DISZIQLL	Strong	Genetic Variation	[9]
Dementia	DISXL1WY	Strong	Biomarker	[10]
Depression	DIS3XJ69	Strong	Biomarker	[5]
Disease of orbital part of eye adnexa	DISGWPWX	Strong	Biomarker	[11]
High blood pressure	DISY2OHH	Strong	Biomarker	[12]
Lupus	DISOKJWA	Strong	Biomarker	[13]
Malaria	DISQ9Y50	Strong	Biomarker	[14]
Neoplasm	DISZKGEW	Strong	Altered Expression	[15]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[12]
Obesity	DIS47Y1K	Strong	Biomarker	[16]
Pneumonia	DIS8EF3M	Strong	Genetic Variation	[17]
Pneumonia caused by gram negative bacteria	DISA4DV0	Strong	Biomarker	[18]
Primary myelofibrosis	DIS6L0CN	Strong	Genetic Variation	[19]
Prostate cancer	DISF190Y	Strong	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[20]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[13]
Coagulation defect	DIS9X3H6	moderate	Genetic Variation	[19]
Myelofibrosis	DISIMP21	moderate	Genetic Variation	[19]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[21]
Niemann-Pick disease type C	DIS492ZO	moderate	Biomarker	[21]
Colorectal adenocarcinoma	DISPQOUB	Limited	Biomarker	[22]
Myotonic dystrophy type 1	DISJC0OX	Limited	Biomarker	[23]
Schistosomiasis	DIS6PD44	Limited	Biomarker	[24]
Thrombocytopenia	DISU61YW	Limited	Genetic Variation	[25]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[23]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Neurobeachin-like protein 2 (NBEAL2).	[26]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Neurobeachin-like protein 2 (NBEAL2).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Neurobeachin-like protein 2 (NBEAL2).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Neurobeachin-like protein 2 (NBEAL2).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Neurobeachin-like protein 2 (NBEAL2).	[32]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Neurobeachin-like protein 2 (NBEAL2).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Neurobeachin-like protein 2 (NBEAL2).	[28]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Neurobeachin-like protein 2 (NBEAL2).	[29]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Neurobeachin-like protein 2 (NBEAL2).	[30]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Neurobeachin-like protein 2 (NBEAL2).	[31]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Neurobeachin-like protein 2 (NBEAL2).	[33]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Neurobeachin-like protein 2 (NBEAL2).	[35]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] A novel retroviral mutagenesis screen identifies prognostic genes in RUNX1 mediated myeloid leukemogenesis.Oncotarget. 2015 Oct 13;6(31):30664-74. doi: 10.18632/oncotarget.5133.
• [3] Decomposing Oncogenic Transcriptional Signatures to Generate Maps of Divergent Cellular States.Cell Syst. 2017 Aug 23;5(2):105-118.e9. doi: 10.1016/j.cels.2017.08.002.
• [4] Real-Time Detection of Spatial Disorientation in Persons with Mild Cognitive Impairment and Dementia.Gerontology. 2020;66(1):85-94. doi: 10.1159/000500971. Epub 2019 Jul 30.
• [5] Using Mobile Sensing to Test Clinical Models of Depression, Social Anxiety, State Affect, and Social Isolation Among College Students.J Med Internet Res. 2017 Mar 3;19(3):e62. doi: 10.2196/jmir.6820.
• [6] Integrated assessment of exposure to PM(2.5) in South India and its relation with cardiovascular risk: Design of the CHAI observational cohort study.Int J Hyg Environ Health. 2017 Aug;220(6):1081-1088. doi: 10.1016/j.ijheh.2017.05.005. Epub 2017 Jun 3.
• [7] The incidence, prevalence and trends of Chronic Kidney Disease and Chronic Kidney Disease of uncertain aetiology (CKDu) in the North Central Province of Sri Lanka: an analysis of 30,566 patients.BMC Nephrol. 2019 Aug 28;20(1):338. doi: 10.1186/s12882-019-1501-0.
• [8] Validation of Prognosis Value of Cumulative Prognostic Scores Based on Serum High-Density Lipoprotein Cholesterol and Albumin Levels in Patients with Colorectal Cancer.J Cancer. 2019 Jan 1;10(1):35-42. doi: 10.7150/jca.26637. eCollection 2019.
• [9] Identification of novel pathogenic F13A1 mutation and novel NBEAL2 gene missense mutation in a pedigree with hereditary congenital factor XIII deficiency.Gene. 2019 Jun 20;702:143-147. doi: 10.1016/j.gene.2019.03.067. Epub 2019 Mar 29.
• [10] Implementation and evaluation of a driving cessation intervention to improve community mobility and wellbeing outcomes for people living with dementia: study protocol of the 'CarFreeMe' for people with dementia program.BMC Geriatr. 2019 Mar 4;19(1):66. doi: 10.1186/s12877-019-1074-6.
• [11] Evaluation of the GPS Precise Orbit and Clock Corrections from MADOCA Real-Time Products.Sensors (Basel). 2019 Jun 6;19(11):2580. doi: 10.3390/s19112580.
• [12] Association of serum levels of p,p'- Dichlorodiphenyldichloroethylene (DDE) with type 2 diabetes in African American and Caucasian adult men from agricultural (Delta) and non-agricultural (non-Delta) regions of Mississippi.J Toxicol Environ Health A. 2019;82(6):387-400. doi: 10.1080/15287394.2019.1610678. Epub 2019 May 7.
• [13] Energetics and evasion dynamics of large predators and prey: pumas vs. hounds.PeerJ. 2017 Aug 17;5:e3701. doi: 10.7717/peerj.3701. eCollection 2017.
• [14] The use of GPS data loggers to describe the impact of spatio-temporal movement patterns on malaria control in a high-transmission area of northern Zambia.Int J Health Geogr. 2019 Aug 19;18(1):19. doi: 10.1186/s12942-019-0183-y.
• [15] Gene expression in normal-appearing tissue adjacent to prostate cancers are predictive of clinical outcome: evidence for a biologically meaningful field effect.Oncotarget. 2016 Jun 7;7(23):33855-65. doi: 10.18632/oncotarget.8944.
• [16] Combined effect of established BMI loci on obesity-related traits in an Algerian population sample.BMC Genet. 2014 Nov 25;15:128. doi: 10.1186/s12863-014-0128-1.
• [17] Pneumonia risk of people living close to goat and poultry farms - Taking GPS derived mobility patterns into account.Environ Int. 2018 Jun;115:150-160. doi: 10.1016/j.envint.2018.03.020. Epub 2018 Mar 28.
• [18] Nbeal2 Deficiency Increases Organ Damage but Does Not Affect Host Defense During Gram-Negative Pneumonia-Derived Sepsis.Arterioscler Thromb Vasc Biol. 2018 Aug;38(8):1772-1784. doi: 10.1161/ATVBAHA.118.311332.
• [19] A Case of Chronic Thrombocytopenia in a 17-Year-Old Female.Lab Med. 2019 Oct 10;50(4):406-420. doi: 10.1093/labmed/lmz013.
• [20] Use of a 17-Gene Prognostic Assay in Contemporary Urologic Practice: Results of an Interim Analysis in an Observational Cohort.Urology. 2017 Sep;107:67-75. doi: 10.1016/j.urology.2017.02.052. Epub 2017 Apr 25.
• [21] The Ratio of C-Reactive Protein/Albumin is a Novel Inflammatory Predictor of Overall Survival in Cisplatin-Based Treated Patients with Metastatic Nasopharyngeal Carcinoma.Dis Markers. 2017;2017:6570808. doi: 10.1155/2017/6570808. Epub 2017 Jun 6.
• [22] A qualitative transcriptional signature for determining the grade of colorectal adenocarcinoma.Cancer Gene Ther. 2020 Sep;27(9):680-690. doi: 10.1038/s41417-019-0139-1. Epub 2019 Oct 9.
• [23] An Unambiguous Delay-And-Multiply Acquisition Scheme for GPS L1C Signals.Sensors (Basel). 2018 May 28;18(6):1739. doi: 10.3390/s18061739.
• [24] Geographical and behavioral risks associated with Schistosoma haematobium infection in an area of complex transmission.Parasit Vectors. 2018 Aug 25;11(1):481. doi: 10.1186/s13071-018-3064-5.
• [25] NBEAL2 mutations and bleeding in patients with gray platelet syndrome.Platelets. 2018 Sep;29(6):632-635. doi: 10.1080/09537104.2018.1478405. Epub 2018 Jun 5.
• [26] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [27] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [30] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [31] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [32] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [33] Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
• [34] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [35] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [36] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.