Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOJC8DV)

• DOT Name: B-cell antigen receptor complex-associated protein alpha chain (CD79A)
• Synonyms: Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a
• Gene Name: CD79A
• Related Disease:
  Acne vulgaris
  Agammaglobulinemia 3, autosomal recessive
  Psoriasis
  Rheumatoid arthritis
  Acute leukaemia
  Acute myelogenous leukaemia
  Agammaglobulinemia
  Atopic dermatitis
  Attention deficit hyperactivity disorder
  Autism spectrum disorder
  B-cell lymphoma
  Breast neoplasm
  Bruton-type agammaglobulinemia
  Central nervous system lymphoma
  Classic Hodgkin lymphoma
  Congenital diaphragmatic hernia
  Endometriosis
  Ewing sarcoma
  Glomerulonephritis
  leukaemia
  Lung cancer
  Lung carcinoma
  Lymphoblastic lymphoma
  Lymphoma
  MALT lymphoma
  Mantle cell lymphoma
  Non-hodgkin lymphoma
  Obesity
  Plasma cell myeloma
  Primary biliary cholangitis
  Schizophrenia
  Small lymphocytic lymphoma
  T-cell acute lymphoblastic leukaemia
  Vasculitis
  Burkitt lymphoma
  IgA nephropathy
  Autosomal agammaglobulinemia
  Primary cutaneous peripheral T-cell lymphoma not otherwise specified
  Acute lymphocytic leukaemia
  Adult lymphoma
  Childhood acute lymphoblastic leukemia
  Leukemia
  Nasopharyngeal carcinoma
  Pediatric lymphoma
  Waldenstrom macroglobulinemia
• UniProt ID: CD79A_HUMAN
• PDB ID: 1CV9; 7WSO; 7WSP; 7XQ8; 7XT6
• Pfam ID: PF00047 ; PF02189
• Sequence:
  MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSN
  NANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCG
  TYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGD
  EYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
• Function: Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
• Tissue Specificity: B-cells.
• KEGG Pathway:
  B cell receptor sig.ling pathway (hsa04662)
  Primary immunodeficiency (hsa05340)
• Reactome Pathway:
  Potential therapeutics for SARS (R-HSA-9679191)
  Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695)
  CD22 mediated BCR regulation (R-HSA-5690714)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acne vulgaris	DISKW8PI	Definitive	Biomarker	[1]
Agammaglobulinemia 3, autosomal recessive	DIST9HCD	Definitive	Autosomal recessive	[2]
Psoriasis	DIS59VMN	Definitive	Biomarker	[3]
Rheumatoid arthritis	DISTSB4J	Definitive	Altered Expression	[4]
Acute leukaemia	DISDQFDI	Strong	Altered Expression	[5]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[5]
Agammaglobulinemia	DISXMS80	Strong	Genetic Variation	[6]
Atopic dermatitis	DISTCP41	Strong	Biomarker	[7]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[8]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[8]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[10]
Bruton-type agammaglobulinemia	DISQ5ZYP	Strong	Genetic Variation	[11]
Central nervous system lymphoma	DISBYQTA	Strong	Biomarker	[12]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[13]
Congenital diaphragmatic hernia	DIS0IPVU	Strong	Biomarker	[14]
Endometriosis	DISX1AG8	Strong	Biomarker	[15]
Ewing sarcoma	DISQYLV3	Strong	Biomarker	[16]
Glomerulonephritis	DISPZIQ3	Strong	Altered Expression	[17]
leukaemia	DISS7D1V	Strong	Biomarker	[18]
Lung cancer	DISCM4YA	Strong	Altered Expression	[10]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[10]
Lymphoblastic lymphoma	DISB9ZYC	Strong	Altered Expression	[19]
Lymphoma	DISN6V4S	Strong	Genetic Variation	[20]
MALT lymphoma	DIS1AVVE	Strong	Altered Expression	[21]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[22]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Altered Expression	[23]
Obesity	DIS47Y1K	Strong	Genetic Variation	[24]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[25]
Primary biliary cholangitis	DIS43E0O	Strong	Biomarker	[26]
Schizophrenia	DISSRV2N	Strong	Biomarker	[8]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[27]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Strong	Altered Expression	[28]
Vasculitis	DISQRKDX	Strong	Biomarker	[29]
Burkitt lymphoma	DIS9D5XU	moderate	Biomarker	[21]
IgA nephropathy	DISZ8MTK	moderate	Genetic Variation	[30]
Autosomal agammaglobulinemia	DISRW8BT	Supportive	Autosomal dominant	[11]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified	DIS5OHQF	Disputed	Biomarker	[31]
Acute lymphocytic leukaemia	DISPX75S	Limited	Biomarker	[32]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[33]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Limited	Biomarker	[32]
Leukemia	DISNAKFL	Limited	Biomarker	[34]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[35]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[33]
Waldenstrom macroglobulinemia	DIS9O23I	Limited	Biomarker	[36]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[43]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[39]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[40]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[41]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[42]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[45]
Rutin	DMEHRAJ	Investigative	Rutin decreases the expression of B-cell antigen receptor complex-associated protein alpha chain (CD79A).	[46]

References

• [1] Randomized controlled double-blind study of a cleanser composed of 5-aminolevulinic acid and peptides on mild and moderate acne vulgaris.J Cosmet Dermatol. 2020 Jul;19(7):1745-1750. doi: 10.1111/jocd.13232. Epub 2019 Nov 28.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Safety and efficacy of halobetasol propionate lotion 0.01% in the treatment of moderate to severe plaque psoriasis: a pooled analysis of 2 phase 3 studies.Cutis. 2019 Feb;103(2):111-116.
• [4] B cells expressing the IgA receptor FcRL4 participate in the autoimmune response in patients with rheumatoid arthritis.J Autoimmun. 2017 Jul;81:34-43. doi: 10.1016/j.jaut.2017.03.004. Epub 2017 Mar 24.
• [5] RUNX1 Mutations Can Lead to Aberrant Expression of CD79a and PAX5 in Acute Myelogenous Leukemias: A Potential Diagnostic Pitfall.Pathobiology. 2019;86(2-3):162-166. doi: 10.1159/000493688. Epub 2018 Nov 5.
• [6] IgM Augments Complement Bactericidal Activity with Serum from a Patient with a Novel CD79a Mutation.J Clin Immunol. 2018 Feb;38(2):185-192. doi: 10.1007/s10875-017-0474-7. Epub 2018 Jan 15.
• [7] Temperature-controlled laminar airflow (TLA) device in the treatment of children with severe atopic eczema: Open-label, proof-of-concept study.Clin Exp Allergy. 2018 May;48(5):594-603. doi: 10.1111/cea.13105. Epub 2018 Mar 13.
• [8] Reduced neonatal brain-derived neurotrophic factor is associated with autism spectrum disorders.Transl Psychiatry. 2019 Oct 7;9(1):252. doi: 10.1038/s41398-019-0587-2.
• [9] Blockade of oncogenic IB kinase activity in diffuse large B-cell lymphoma by bromodomain and extraterminal domain protein inhibitors. Proc Natl Acad Sci U S A. 2014 Aug 5;111(31):11365-70. doi: 10.1073/pnas.1411701111. Epub 2014 Jul 21.
• [10] Expression of the B-cell receptor component CD79a on immature myeloid cells contributes to their tumor promoting effects.PLoS One. 2013 Oct 16;8(10):e76115. doi: 10.1371/journal.pone.0076115. eCollection 2013.
• [11] Novel Igalpha (CD79a) gene mutation in a Turkish patient with B cell-deficient agammaglobulinemia. Am J Med Genet. 2002 Apr 1;108(4):333-6. doi: 10.1002/ajmg.10296.
• [12] Intracranial Cell Lymphomas That Mimic Meningiomas: Case Report To Understand Complex Genetic, Radiologic, and Histopathologic Entities.World Neurosurg. 2019 May;125:339-342. doi: 10.1016/j.wneu.2019.01.298. Epub 2019 Feb 22.
• [13] Concurrent Hodgkin's disease (mixed cellularity type) and T-cell chronic lymphocytic leukemia/prolymphocytic leukemia.Int J Hematol. 2001 Feb;73(2):230-5. doi: 10.1007/BF02981943.
• [14] Genomic alterations in a case of alpha heavy chain disease leading to the generation of composite exons from the JH region.Eur J Immunol. 1989 Nov;19(11):2093-8. doi: 10.1002/eji.1830191119.
• [15] Clinical, morphological and immunohistochemical survey in different types of endometriosis.Rom J Morphol Embryol. 2018;59(4):1133-1153.
• [16] Differentiating lymphoblastic lymphoma and Ewing's sarcoma: lymphocyte markers and gene rearrangement.Mod Pathol. 2001 Nov;14(11):1175-82. doi: 10.1038/modpathol.3880455.
• [17] 1,4-galactosyltransferase 1 is a novel receptor for IgA in human mesangial cells.Kidney Int. 2017 Dec;92(6):1458-1468. doi: 10.1016/j.kint.2017.05.002. Epub 2017 Jul 24.
• [18] CD79a expression in acute myeloid leukemia t(8;21) and the importance of cytogenetics in the diagnosis of leukemias with immunophenotypic ambiguity.Cancer Genet Cytogenet. 2005 Nov;163(1):62-7. doi: 10.1016/j.cancergencyto.2005.06.002.
• [19] Gene rearrangements in T-cell lymphoblastic lymphoma.J Pathol. 1999 Jul;188(3):267-70. doi: 10.1002/(SICI)1096-9896(199907)188:3<267::AID-PATH357>3.0.CO;2-N.
• [20] Immunohistochemical distinction of ABC and GCB in extranodal DLBCL is not reflected in mutation patterns.Leuk Res. 2019 Jan;76:107-111. doi: 10.1016/j.leukres.2018.10.003. Epub 2018 Oct 10.
• [21] Chronic active B-cell-receptor signalling in diffuse large B-cell lymphoma.Nature. 2010 Jan 7;463(7277):88-92. doi: 10.1038/nature08638.
• [22] SOX11 augments BCR signaling to drive MCL-like tumor development.Blood. 2018 May 17;131(20):2247-2255. doi: 10.1182/blood-2018-02-832535. Epub 2018 Apr 3.
• [23] Antibody-drug conjugates targeted to CD79 for the treatment of non-Hodgkin lymphoma.Blood. 2007 Jul 15;110(2):616-23. doi: 10.1182/blood-2007-01-066704. Epub 2007 Mar 20.
• [24] Relationship between variants of the leptin gene and obesity and metabolic biomarkers in Brazilian individuals.Arq Bras Endocrinol Metabol. 2010 Mar;54(3):282-8. doi: 10.1590/s0004-27302010000300006.
• [25] An unusual presentation of multiple myeloma with unilateral sudden vision loss: A case report.Medicine (Baltimore). 2017 Jun;96(25):e7277. doi: 10.1097/MD.0000000000007277.
• [26] Immunopathogenesis of primary biliary cirrhosis.Semin Liver Dis. 2002 Aug;22(3):291-302. doi: 10.1055/s-2002-34506.
• [27] 11q22.3 deletion in B-chronic lymphocytic leukemia is specifically associated with bulky lymphadenopathy and ZAP-70 expression but not reduced expression of adhesion/cell surface receptor molecules.Leuk Lymphoma. 2006 Feb;47(2):231-44. doi: 10.1080/10428190500254141.
• [28] Immunohistochemical detection of CD79a expression in precursor T cell lymphoblastic lymphoma/leukaemias.J Pathol. 2002 Jul;197(3):341-7. doi: 10.1002/path.1126.
• [29] New insights in the pathogenesis of immunoglobulin A vasculitis (Henoch-Schnlein purpura).Autoimmun Rev. 2017 Dec;16(12):1246-1253. doi: 10.1016/j.autrev.2017.10.009. Epub 2017 Oct 14.
• [30] Reproducibility of the Oxford classification of immunoglobulin A nephropathy, impact of biopsy scoring on treatment allocation and clinical relevance of disagreements: evidence from the VALidation of IGA study cohort.Nephrol Dial Transplant. 2019 Oct 1;34(10):1681-1690. doi: 10.1093/ndt/gfy337.
• [31] Peripheral T-cell lymphoma with extensive dendritic cell network mimicking follicular dendritic cell tumor: a case report with pathologic, immunophenotypic, and molecular findings.Am J Clin Pathol. 2006 Aug;126(2):230-4. doi: 10.1309/Q1YK-AU1X-XEN3-NVKQ.
• [32] Biphenotypic acute leukemia with coexpression of CD79a and markers of myeloid lineage.Arch Pathol Lab Med. 2003 Mar;127(3):356-9. doi: 10.5858/2003-127-0356-BALWCO.
• [33] Anaplastic variant of diffuse large B-cell lymphoma with hallmark cell appearance: Two cases highlighting a broad diversity in the diagnostics.Pathol Int. 2018 Apr;68(4):251-255. doi: 10.1111/pin.12653. Epub 2018 Feb 25.
• [34] CytCD79a expression in acute leukemia with t(8;21): biphenotypic or myeloid leukemia?.Cancer Genet Cytogenet. 2007 Apr 1;174(1):76-7. doi: 10.1016/j.cancergencyto.2006.11.007.
• [35] Identification of a Novel, EBV-Based Antibody Risk Stratification Signature for Early Detection of Nasopharyngeal Carcinoma in Taiwan.Clin Cancer Res. 2018 Mar 15;24(6):1305-1314. doi: 10.1158/1078-0432.CCR-17-1929. Epub 2018 Jan 4.
• [36] Fluorescence immunophenotypic and interphase cytogenetic characterization of nodal lymphoplasmacytic lymphoma.Am J Surg Pathol. 2008 Nov;32(11):1643-53. doi: 10.1097/PAS.0b013e3181758806.
• [37] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [38] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [39] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [40] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [41] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [42] Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] BET bromodomain inhibition as a novel strategy for reactivation of HIV-1. J Leukoc Biol. 2012 Dec;92(6):1147-54. doi: 10.1189/jlb.0312165. Epub 2012 Jul 16.
• [45] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [46] Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.