Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQVOHLT)

• DOT Name: Serine-protein kinase ATM (ATM)
• Synonyms: EC 2.7.11.1; Ataxia telangiectasia mutated; A-T mutated
• Gene Name: ATM
• Related Disease:
  Ataxia-telangiectasia
  Hereditary breast carcinoma
  Hereditary nonpolyposis colon cancer
  Sarcoma
  Familial ovarian cancer
  Prostate cancer
• UniProt ID: ATM_HUMAN
• PDB ID: 5NP0; 5NP1; 6HKA; 6K9K; 6K9L; 7NI4; 7NI5; 7NI6; 7SIC; 7SID; 8OXM; 8OXO; 8OXP; 8OXQ
• EC Number: 2.7.11.1
• Pfam ID: PF02259 ; PF02260 ; PF00454 ; PF11640
• Sequence:
  MSLVLNDLLICCRQLEHDRATERKKEVEKFKRLIRDPETIKHLDRHSDSKQGKYLNWDAV
  FRFLQKYIQKETECLRIAKPNVSASTQASRQKKMQEISSLVKYFIKCANRRAPRLKCQEL
  LNYIMDTVKDSSNGAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFRLYLKPSQ
  DVHRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQCARQEKSSSGLNHILAALTIFL
  KTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
  GAYESTKWRSILYNLYDLLVNEISHIGSRGKYSSGFRNIAVKENLIELMADICHQVFNED
  TRSLEISQSYTTTQRESSDYSVPCKRKKIELGWEVIKDHLQKSQNDFDLVPWLQIATQLI
  SKYPASLPNCELSPLLMILSQLLPQQRHGERTPYVLRCLTEVALCQDKRSNLESSQKSDL
  LKLWNKIWCITFRGISSEQIQAENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
  CLTLALTTSIVPGTVKMGIEQNMCEVNRSFSLKESIMKWLLFYQLEGDLENSTEVPPILH
  SNFPHLVLEKILVSLTMKNCKAAMNFFQSVPECEHHQKDKEELSFSEVEELFLQTTFDKM
  DFLTIVRECGIEKHQSSIGFSVHQNLKESLDRCLLGLSEQLLNNYSSEITNSETLVRCSR
  LLVGVLGCYCYMGVIAEEEAYKSELFQKAKSLMQCAGESITLFKNKTNEEFRIGSLRNMM
  QLCTRCLSNCTKKSPNKIASGFFLRLLTSKLMNDIADICKSLASFIKKPFDRGEVESMED
  DTNGNLMEVEDQSSMNLFNDYPDSSVSDANEPGESQSTIGAINPLAEEYLSKQDLLFLDM
  LKFLCLCVTTAQTNTVSFRAADIRRKLLMLIDSSTLEPTKSLHLHMYLMLLKELPGEEYP
  LPMEDVLELLKPLSNVCSLYRRDQDVCKTILNHVLHVVKNLGQSNMDSENTRDAQGQFLT
  VIGAFWHLTKERKYIFSVRMALVNCLKTLLEADPYSKWAILNVMGKDFPVNEVFTQFLAD
  NHHQVRMLAAESINRLFQDTKGDSSRLLKALPLKLQQTAFENAYLKAQEGMREMSHSAEN
  PETLDEIYNRKSVLLTLIAVVLSCSPICEKQALFALCKSVKENGLEPHLVKKVLEKVSET
  FGYRRLEDFMASHLDYLVLEWLNLQDTEYNLSSFPFILLNYTNIEDFYRSCYKVLIPHLV
  IRSHFDEVKSIANQIQEDWKSLLTDCFPKILVNILPYFAYEGTRDSGMAQQRETATKVYD
  MLKSENLLGKQIDHLFISNLPEIVVELLMTLHEPANSSASQSTDLCDFSGDLDPAPNPPH
  FPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRILK
  IYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQRPSCIMDVSLRSFSLCCDLLSQ
  VCQTAVTYCKDALENHLHVIVGTLIPLVYEQVEVQKQVLDLLKYLVIDNKDNENLYITIK
  LLDPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRRQ
  LELHKDQMVDIMRASQDNPQDGIMVKLVVNLLQLSKMAINHTGEKEVLEAVGSCLGEVGP
  IDFSTIAIQHSKDASYTKALKLFEDKELQWTFIMLTYLNNTLVEDCVKVRSAAVTCLKNI
  LATKTGHSFWEIYKMTTDPMLAYLQPFRTSRKKFLEVPRFDKENPFEGLDDINLWIPLSE
  NHDIWIKTLTCAFLDSGGTKCEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWRN
  LLSTHVQGFFTSCLRHFSQTSRSTTPANLDSESEHFFRCCLDKKSQRTMLAVVDYMRRQK
  RPSSGTIFNDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRSLAFEEG
  SQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPITRLRTYEHEA
  MWGKALVTYDLETAIPSSTRQAGIIQALQNLGLCHILSVYLKGLDYENKDWCPELEELHY
  QAAWRNMQWDHCTSVSKEVEGTSYHESLYNALQSLRDREFSTFYESLKYARVKEVEEMCK
  RSLESVYSLYPTLSRLQAIGELESIGELFSRSVTHRQLSEVYIKWQKHSQLLKDSDFSFQ
  EPIMALRTVILEILMEKEMDNSQRECIKDILTKHLVELSILARTFKNTQLPERAIFQIKQ
  YNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAANNPSLKLTYTECLRV
  CGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQR
  IENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRK
  RFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLM
  YQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARR
  SRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKT
  QRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPK
  IIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVPL
  SQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEEKYEVF
  MDVCQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINE
  QSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRN
  SQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQ
  SFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKAWV
• Function: Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by the B-cell antigen receptor (BCR) expressed on individual B-lymphocytes. After the introduction of DNA breaks by the RAG complex on one immunoglobulin allele, acts by mediating a repositioning of the second allele to pericentromeric heterochromatin, preventing accessibility to the RAG complex and recombination of the second allele. Also involved in signal transduction and cell cycle control. May function as a tumor suppressor. Necessary for activation of ABL1 and SAPK. Phosphorylates DYRK2, CHEK2, p53/TP53, FBXW7, FANCD2, NFKBIA, BRCA1, CTIP, nibrin (NBN), TERF1, UFL1, RAD9, UBQLN4 and DCLRE1C. May play a role in vesicle and/or protein transport. Could play a role in T-cell development, gonad and neurological function. Plays a role in replication-dependent histone mRNA degradation. Binds DNA ends. Phosphorylation of DYRK2 in nucleus in response to genotoxic stress prevents its MDM2-mediated ubiquitination and subsequent proteasome degradation. Phosphorylates ATF2 which stimulates its function in DNA damage response. Phosphorylates ERCC6 which is essential for its chromatin remodeling activity at DNA double-strand breaks. Phosphorylates TTC5/STRAP at 'Ser-203' in the cytoplasm in response to DNA damage, which promotes TTC5/STRAP nuclear localization. Also involved in pexophagy by mediating phosphorylation of PEX5: translocated to peroxisomes in response to reactive oxygen species (ROS), and catalyzes phosphorylation of PEX5, promoting PEX5 ubiquitination and induction of pexophagy.
• Tissue Specificity: Found in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain, heart, spleen, thymus, testis, ovary, small intestine, colon and leukocytes.
• KEGG Pathway:
  Platinum drug resistance (hsa01524)
  Homologous recombi.tion (hsa03440)
  NF-kappa B sig.ling pathway (hsa04064)
  FoxO sig.ling pathway (hsa04068)
  Cell cycle (hsa04110)
  p53 sig.ling pathway (hsa04115)
  Apoptosis (hsa04210)
  Cellular senescence (hsa04218)
  Shigellosis (hsa05131)
  Human papillomavirus infection (hsa05165)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Human immunodeficiency virus 1 infection (hsa05170)
  Transcriptio.l misregulation in cancer (hsa05202)
  MicroR.s in cancer (hsa05206)
• Reactome Pathway:
  Regulation of HSF1-mediated heat shock response (R-HSA-3371453)
  Autodegradation of the E3 ubiquitin ligase COP1 (R-HSA-349425)
  HDR through Single Strand Annealing (SSA) (R-HSA-5685938)
  HDR through Homologous Recombination (HRR) (R-HSA-5685942)
  Sensing of DNA Double Strand Breaks (R-HSA-5693548)
  Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA) (R-HSA-5693554)
  Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565)
  Resolution of D-loop Structures through Holliday Junction Intermediates (R-HSA-5693568)
  Nonhomologous End-Joining (NHEJ) (R-HSA-5693571)
  Homologous DNA Pairing and Strand Exchange (R-HSA-5693579)
  Processing of DNA double-strand break ends (R-HSA-5693607)
  Presynaptic phase of homologous DNA pairing and strand exchange (R-HSA-5693616)
  TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648)
  TP53 Regulates Transcription of Genes Involved in Cytochrome C Release (R-HSA-6803204)
  TP53 Regulates Transcription of Caspase Activators and Caspases (R-HSA-6803207)
  Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756)
  Regulation of TP53 Degradation (R-HSA-6804757)
  Regulation of TP53 Activity through Methylation (R-HSA-6804760)
  G2/M DNA damage checkpoint (R-HSA-69473)
  Stabilization of p53 (R-HSA-69541)
  Meiotic recombination (R-HSA-912446)
  Pexophagy (R-HSA-9664873)
  Defective homologous recombination repair (HRR) due to BRCA1 loss of function (R-HSA-9701192)
  Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA1 binding function (R-HSA-9704331)
  Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA2/RAD51/RAD51C binding function (R-HSA-9704646)
  Impaired BRCA2 binding to RAD51 (R-HSA-9709570)
  Impaired BRCA2 binding to PALB2 (R-HSA-9709603)
  DNA Damage/Telomere Stress Induced Senescence (R-HSA-2559586)

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ataxia-telangiectasia	DISP3EVR	Definitive	Autosomal recessive	[1]
Hereditary breast carcinoma	DISAEZT5	Definitive	Autosomal dominant	[1]
Hereditary nonpolyposis colon cancer	DISPA49R	Moderate	Autosomal dominant	[1]
Sarcoma	DISZDG3U	Moderate	Autosomal dominant	[2]
Familial ovarian cancer	DISGLR2C	Limited	Autosomal dominant	[1]
Prostate cancer	DISF190Y	Limited	Autosomal dominant	[3]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Serine-protein kinase ATM (ATM) decreases the response to substance of Fluorouracil.	[74]
Aminohippuric acid	DMUN54G	Investigative	Serine-protein kinase ATM (ATM) affects the response to substance of Aminohippuric acid.	[75]
Nitrosoglutathione	DMZ9WI4	Investigative	Serine-protein kinase ATM (ATM) increases the response to substance of Nitrosoglutathione.	[76]

27 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Serine-protein kinase ATM (ATM).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Serine-protein kinase ATM (ATM).	[12]
Temozolomide	DMKECZD	Approved	Temozolomide increases the phosphorylation of Serine-protein kinase ATM (ATM).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the methylation of Serine-protein kinase ATM (ATM).	[20]
Etoposide	DMNH3PG	Approved	Etoposide increases the phosphorylation of Serine-protein kinase ATM (ATM).	[25]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the phosphorylation of Serine-protein kinase ATM (ATM).	[26]
Acocantherin	DM7JT24	Approved	Acocantherin increases the phosphorylation of Serine-protein kinase ATM (ATM).	[31]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea increases the phosphorylation of Serine-protein kinase ATM (ATM).	[33]
Bleomycin	DMNER5S	Approved	Bleomycin increases the phosphorylation of Serine-protein kinase ATM (ATM).	[37]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the acetylation of Serine-protein kinase ATM (ATM).	[39]
Curcumin	DMQPH29	Phase 3	Curcumin increases the phosphorylation of Serine-protein kinase ATM (ATM).	[40]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine increases the phosphorylation of Serine-protein kinase ATM (ATM).	[42]
Remdesivir	DMBFZ6L	Phase 3 Trial	Remdesivir increases the phosphorylation of Serine-protein kinase ATM (ATM).	[44]
VAL-083	DM9J5Q4	Phase 3	VAL-083 increases the phosphorylation of Serine-protein kinase ATM (ATM).	[45]
Genistein	DM0JETC	Phase 2/3	Genistein increases the phosphorylation of Serine-protein kinase ATM (ATM).	[46]
INCB057643	DMG65CV	Phase 1/2	INCB057643 decreases the phosphorylation of Serine-protein kinase ATM (ATM).	[49]
GSK461364	DM0P729	Phase 1	GSK461364 increases the phosphorylation of Serine-protein kinase ATM (ATM).	[51]
Clioquinol	DM746BZ	Withdrawn from market	Clioquinol increases the phosphorylation of Serine-protein kinase ATM (ATM).	[54]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the phosphorylation of Serine-protein kinase ATM (ATM).	[62]
acrolein	DMAMCSR	Investigative	acrolein increases the phosphorylation of Serine-protein kinase ATM (ATM).	[64]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl increases the phosphorylation of Serine-protein kinase ATM (ATM).	[65]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the phosphorylation of Serine-protein kinase ATM (ATM).	[66]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the phosphorylation of Serine-protein kinase ATM (ATM).	[67]
Dorsomorphin	DMKYXJW	Investigative	Dorsomorphin increases the phosphorylation of Serine-protein kinase ATM (ATM).	[69]
USNIC ACID	DMGOURX	Investigative	USNIC ACID increases the phosphorylation of Serine-protein kinase ATM (ATM).	[70]
ABBV-744	DMTEA9C	Investigative	ABBV-744 increases the phosphorylation of Serine-protein kinase ATM (ATM).	[71]
CYANATE	DM6HQDL	Investigative	CYANATE increases the phosphorylation of Serine-protein kinase ATM (ATM).	[72]

48 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Serine-protein kinase ATM (ATM).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Serine-protein kinase ATM (ATM).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Serine-protein kinase ATM (ATM).	[7]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Serine-protein kinase ATM (ATM).	[8]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Serine-protein kinase ATM (ATM).	[9]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Serine-protein kinase ATM (ATM).	[10]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Serine-protein kinase ATM (ATM).	[11]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Serine-protein kinase ATM (ATM).	[13]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Serine-protein kinase ATM (ATM).	[15]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Serine-protein kinase ATM (ATM).	[16]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Serine-protein kinase ATM (ATM).	[17]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Serine-protein kinase ATM (ATM).	[18]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Serine-protein kinase ATM (ATM).	[19]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Serine-protein kinase ATM (ATM).	[21]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Serine-protein kinase ATM (ATM).	[22]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Serine-protein kinase ATM (ATM).	[24]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Serine-protein kinase ATM (ATM).	[27]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Serine-protein kinase ATM (ATM).	[28]
Mitoxantrone	DMM39BF	Approved	Mitoxantrone decreases the expression of Serine-protein kinase ATM (ATM).	[8]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Serine-protein kinase ATM (ATM).	[29]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Serine-protein kinase ATM (ATM).	[30]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Serine-protein kinase ATM (ATM).	[32]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Serine-protein kinase ATM (ATM).	[32]
Bexarotene	DMOBIKY	Approved	Bexarotene increases the activity of Serine-protein kinase ATM (ATM).	[34]
Etretinate	DM2CZFA	Approved	Etretinate increases the activity of Serine-protein kinase ATM (ATM).	[34]
Gentamicin	DMKINJO	Approved	Gentamicin increases the expression of Serine-protein kinase ATM (ATM).	[35]
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone decreases the expression of Serine-protein kinase ATM (ATM).	[36]
Pentamidine	DMHZJCG	Approved	Pentamidine decreases the activity of Serine-protein kinase ATM (ATM).	[38]
Paromomycin	DM1AGXN	Approved	Paromomycin increases the expression of Serine-protein kinase ATM (ATM).	[35]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin decreases the expression of Serine-protein kinase ATM (ATM).	[41]
Napabucasin	DMDZ6Q3	Phase 3	Napabucasin decreases the expression of Serine-protein kinase ATM (ATM).	[43]
Lithium	DMZ3OU6	Phase 2	Lithium decreases the expression of Serine-protein kinase ATM (ATM).	[47]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 increases the expression of Serine-protein kinase ATM (ATM).	[48]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Serine-protein kinase ATM (ATM).	[50]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Serine-protein kinase ATM (ATM).	[52]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the activity of Serine-protein kinase ATM (ATM).	[53]
EMODIN	DMAEDQG	Terminated	EMODIN increases the expression of Serine-protein kinase ATM (ATM).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Serine-protein kinase ATM (ATM).	[56]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Serine-protein kinase ATM (ATM).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Serine-protein kinase ATM (ATM).	[58]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Serine-protein kinase ATM (ATM).	[59]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Serine-protein kinase ATM (ATM).	[11]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Serine-protein kinase ATM (ATM).	[60]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Serine-protein kinase ATM (ATM).	[61]
Manganese	DMKT129	Investigative	Manganese decreases the expression of Serine-protein kinase ATM (ATM).	[63]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Serine-protein kinase ATM (ATM).	[68]
G418	DMKTJBU	Investigative	G418 increases the expression of Serine-protein kinase ATM (ATM).	[35]
KU-55933	DMDT42X	Investigative	KU-55933 decreases the activity of Serine-protein kinase ATM (ATM).	[73]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bortezomib	DMNO38U	Approved	Bortezomib increases the cleavage of Serine-protein kinase ATM (ATM).	[23]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Monogenic and polygenic determinants of sarcoma risk: an international genetic study. Lancet Oncol. 2016 Sep;17(9):1261-71. doi: 10.1016/S1470-2045(16)30147-4. Epub 2016 Aug 4.
• [3] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [6] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [7] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [8] Dynamic coregulatory complex containing BRCA1, E2F1 and CtIP controls ATM transcription. Cell Physiol Biochem. 2012;30(3):596-608. doi: 10.1159/000341441. Epub 2012 Jul 27.
• [9] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [10] Mechanism of cisplatin proximal tubule toxicity revealed by integrating transcriptomics, proteomics, metabolomics and biokinetics. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):117-27.
• [11] Differential effect of methyl-, butyl- and propylparaben and 17-estradiol on selected cell cycle and apoptosis gene and protein expression in MCF-7 breast cancer cells and MCF-10A non-malignant cells. J Appl Toxicol. 2014 Sep;34(9):1041-50. doi: 10.1002/jat.2978. Epub 2014 Jan 30.
• [12] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [13] Multifaceted preventive effects of single agent quercetin on a human prostate adenocarcinoma cell line (PC-3): implications for nutritional transcriptomics and multi-target therapy. Med Oncol. 2011 Dec;28(4):1395-404. doi: 10.1007/s12032-010-9603-3. Epub 2010 Jul 2.
• [14] Resveratrol abrogates the temozolomide-induced G2 arrest leading to mitotic catastrophe and reinforces the temozolomide-induced senescence in glioma cells. BMC Cancer. 2013 Mar 22;13:147. doi: 10.1186/1471-2407-13-147.
• [15] Arsenic trioxide induces apoptosis in NB-4, an acute promyelocytic leukemia cell line, through up-regulation of p73 via suppression of nuclear factor kappa B-mediated inhibition of p73 transcription and prevention of NF-kappaB-mediated induction of XIAP, cIAP2, BCL-XL and survivin. Med Oncol. 2010 Sep;27(3):833-42. doi: 10.1007/s12032-009-9294-9. Epub 2009 Sep 10.
• [16] Pro-oxidant induced DNA damage in human lymphoblastoid cells: homeostatic mechanisms of genotoxic tolerance. Toxicol Sci. 2012 Aug;128(2):387-97. doi: 10.1093/toxsci/kfs152. Epub 2012 Apr 26.
• [17] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [18] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [19] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [20] Carbon Nanotube- and Asbestos-Induced DNA and RNA Methylation Changes in Bronchial Epithelial Cells. Chem Res Toxicol. 2019 May 20;32(5):850-860. doi: 10.1021/acs.chemrestox.8b00406. Epub 2019 Apr 23.
• [21] Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
• [22] Cannabidiol Induces Cell Cycle Arrest and Cell Apoptosis in Human Gastric Cancer SGC-7901 Cells. Biomolecules. 2019 Jul 25;9(8):302. doi: 10.3390/biom9080302.
• [23] Molecular mechanisms mediating antimyeloma activity of proteasome inhibitor PS-341. Blood. 2003 Feb 15;101(4):1530-4. doi: 10.1182/blood-2002-08-2543. Epub 2002 Sep 26.
• [24] Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
• [25] Amsacrine downregulates BCL2L1 expression and triggers apoptosis in human chronic myeloid leukemia cells through the SIDT2/NOX4/ERK/HuR pathway. Toxicol Appl Pharmacol. 2023 Sep 1;474:116625. doi: 10.1016/j.taap.2023.116625. Epub 2023 Jul 13.
• [26] Irinotecan induces senescence and apoptosis in colonic cells in vitro. Toxicol Lett. 2012 Oct 2;214(1):1-8. doi: 10.1016/j.toxlet.2012.08.004. Epub 2012 Aug 14.
• [27] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [28] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [29] Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
• [30] Daunorubicin-induced variations in gene transcription: commitment to proliferation arrest, senescence and apoptosis. Biochem J. 2003 Jun 15;372(Pt 3):703-11. doi: 10.1042/BJ20021950.
• [31] Ouabain induces apoptotic cell death in human prostate DU 145 cancer cells through DNA damage and TRAIL pathways. Environ Toxicol. 2019 Dec;34(12):1329-1339. doi: 10.1002/tox.22834. Epub 2019 Aug 21.
• [32] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [33] PLK1 targets NOTCH1 during DNA damage and mitotic progression. J Biol Chem. 2019 Nov 22;294(47):17941-17950. doi: 10.1074/jbc.RA119.009881. Epub 2019 Oct 9.
• [34] Bexarotene activates the p53/p73 pathway in human cutaneous T-cell lymphoma. Br J Dermatol. 2009 Mar;160(3):519-26. doi: 10.1111/j.1365-2133.2008.08931.x. Epub 2008 Nov 25.
• [35] Correction of ATM gene function by aminoglycoside-induced read-through of premature termination codons. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15676-81. doi: 10.1073/pnas.0405155101. Epub 2004 Oct 21.
• [36] The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
• [37] Direct activation of ATM by resveratrol under oxidizing conditions. PLoS One. 2014 Jun 16;9(6):e97969. doi: 10.1371/journal.pone.0097969. eCollection 2014.
• [38] Bisbenzamidine derivative, pentamidine represses DNA damage response through inhibition of histone H2A acetylation. Mol Cancer. 2010 Feb 9;9:34. doi: 10.1186/1476-4598-9-34.
• [39] A human tRNA synthetase is a potent PARP1-activating effector target for resveratrol. Nature. 2015 Mar 19;519(7543):370-3. doi: 10.1038/nature14028. Epub 2014 Dec 22.
• [40] Activation of ATM/Chk1 by curcumin causes cell cycle arrest and apoptosis in human pancreatic cancer cells. Br J Cancer. 2009 May 5;100(9):1425-33. doi: 10.1038/sj.bjc.6605039.
• [41] Myristicin from nutmeg induces apoptosis via the mitochondrial pathway and down regulates genes of the DNA damage response pathways in human leukaemia K562 cells. Chem Biol Interact. 2014 Jul 25;218:1-9. doi: 10.1016/j.cbi.2014.04.014. Epub 2014 Apr 29.
• [42] Ataxia telangiectasia-mutated and p53 are potential mediators of chloroquine-induced resistance to mammary carcinogenesis. Cancer Res. 2007 Dec 15;67(24):12026-33. doi: 10.1158/0008-5472.CAN-07-3058.
• [43] Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
• [44] An in vitro study on anti-carcinogenic effect of remdesivir in human ovarian cancer cells via generation of reactive oxygen species. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271221089257. doi: 10.1177/09603271221089257.
• [45] 1,2:5,6-dianhydrogalactitol inhibits human glioma cell growth in vivo and in vitro by arresting the cell cycle at G(2)/M phase. Acta Pharmacol Sin. 2017 Apr;38(4):561-570. doi: 10.1038/aps.2016.154. Epub 2017 Feb 20.
• [46] The isoflavonoids genistein and quercetin activate different stress signaling pathways as shown by analysis of site-specific phosphorylation of ATM, p53 and histone H2AX. DNA Repair (Amst). 2004 Mar 4;3(3):235-44. doi: 10.1016/j.dnarep.2003.10.014.
• [47] Effect of mood stabilizers on gene expression in lymphoblastoid cells. J Neural Transm (Vienna). 2010 Feb;117(2):155-64.
• [48] OTX015 Epi-Drug Exerts Antitumor Effects in Ovarian Cancer Cells by Blocking GNL3-Mediated Radioresistance Mechanisms: Cellular, Molecular and Computational Evidence. Cancers (Basel). 2021 Mar 25;13(7):1519. doi: 10.3390/cancers13071519.
• [49] The synergy of the XPO1 inhibitors combined with the BET inhibitor INCB057643 in high-grade B-cell lymphoma via downregulation of MYC expression. Sci Rep. 2023 Oct 29;13(1):18554. doi: 10.1038/s41598-023-45721-z.
• [50] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [51] A specific inhibitor of polo-like kinase 1, GSK461364A, suppresses proliferation of Raji Burkitt's lymphoma cells through mediating cell cycle arrest, DNA damage, and apoptosis. Chem Biol Interact. 2020 Dec 1;332:109288. doi: 10.1016/j.cbi.2020.109288. Epub 2020 Oct 17.
• [52] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [53] Caffeine inhibits the checkpoint kinase ATM. Curr Biol. 1999 Oct 7;9(19):1135-8. doi: 10.1016/s0960-9822(99)80486-2.
• [54] Clioquinol induces DNA double-strand breaks, activation of ATM, and subsequent activation of p53 signaling. Toxicology. 2012 Sep 4;299(1):55-9. doi: 10.1016/j.tox.2012.05.013. Epub 2012 May 22.
• [55] Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
• [56] Quercetin and Its Fermented Extract as a Potential Inhibitor of Bisphenol A-Exposed HT-29 Colon Cancer Cells' Viability. Int J Mol Sci. 2023 Mar 15;24(6):5604. doi: 10.3390/ijms24065604.
• [57] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [58] Evaluating biotoxicity with fibroblasts derived from human embryonic stem cells. Toxicol In Vitro. 2012 Sep;26(6):1056-63. doi: 10.1016/j.tiv.2012.04.002. Epub 2012 Apr 16.
• [59] Induction of DNA damage by deguelin is mediated through reducing DNA repair genes in human non-small cell lung cancer NCI-H460 cells. Oncol Rep. 2012 Apr;27(4):959-64. doi: 10.3892/or.2012.1622. Epub 2012 Jan 4.
• [60] Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
• [61] Gallic acid provokes DNA damage and suppresses DNA repair gene expression in human prostate cancer PC-3 cells. Environ Toxicol. 2013 Oct;28(10):579-87. doi: 10.1002/tox.20752. Epub 2011 Sep 2.
• [62] Inactivation of ATM/ATR DNA damage checkpoint promotes androgen induced chromosomal instability in prostate epithelial cells. PLoS One. 2012;7(12):e51108. doi: 10.1371/journal.pone.0051108. Epub 2012 Dec 18.
• [63] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [64] Toxicity mechanism of acrolein on DNA damage and apoptosis in BEAS-2B cells: Insights from cell biology and molecular docking analyses. Toxicology. 2022 Jan 30;466:153083. doi: 10.1016/j.tox.2021.153083. Epub 2021 Dec 24.
• [65] Low-dose tributyltin triggers human chondrocyte senescence and mouse articular cartilage aging. Arch Toxicol. 2023 Feb;97(2):547-559. doi: 10.1007/s00204-022-03407-x. Epub 2022 Nov 1.
• [66] Lead (Pb) induced ATM-dependent mitophagy via PINK1/Parkin pathway. Toxicol Lett. 2018 Jul;291:92-100. doi: 10.1016/j.toxlet.2018.04.012. Epub 2018 Apr 13.
• [67] Kaempferol induces apoptosis in human HCT116 colon cancer cells via the Ataxia-Telangiectasia Mutated-p53 pathway with the involvement of p53 Upregulated Modulator of Apoptosis. Chem Biol Interact. 2009 Jan 27;177(2):121-7. doi: 10.1016/j.cbi.2008.10.048. Epub 2008 Nov 5.
• [68] Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
• [69] p53 modulates the AMPK inhibitor compound C induced apoptosis in human skin cancer cells. Toxicol Appl Pharmacol. 2013 Feb 15;267(1):113-24. doi: 10.1016/j.taap.2012.12.016. Epub 2012 Dec 27.
• [70] Usnic acid induces apoptosis in human gastric cancer cells through ROS generation and DNA damage and causes up-regulation of DNA-PKcs and -H2A.X phosphorylation. Chem Biol Interact. 2020 Jan 5;315:108898. doi: 10.1016/j.cbi.2019.108898. Epub 2019 Nov 9.
• [71] ABBV-744 induces autophagy in gastric cancer cells by regulating PI3K/AKT/mTOR/p70S6k and MAPK signaling pathways. Neoplasia. 2023 Nov;45:100936. doi: 10.1016/j.neo.2023.100936. Epub 2023 Sep 26.
• [72] Isocyanates induces DNA damage, apoptosis, oxidative stress, and inflammation in cultured human lymphocytes. J Biochem Mol Toxicol. 2008 Nov-Dec;22(6):429-40.
• [73] Checkpoint signaling, base excision repair, and PARP promote survival of colon cancer cells treated with 5-fluorodeoxyuridine but not 5-fluorouracil. PLoS One. 2011;6(12):e28862. doi: 10.1371/journal.pone.0028862. Epub 2011 Dec 15.
• [74] The epigenetic modifier HDAC2 and the checkpoint kinase ATM determine the responses of microsatellite instable colorectal cancer cells to 5-fluorouracil. Cell Biol Toxicol. 2023 Oct;39(5):2401-2419. doi: 10.1007/s10565-022-09731-3. Epub 2022 May 24.
• [75] Modulation of DNA repair capacity by ataxia telangiectasia mutated gene polymorphisms among polycyclic aromatic hydrocarbons-exposed workers. Toxicol Sci. 2011 Nov;124(1):99-108. doi: 10.1093/toxsci/kfr216. Epub 2011 Aug 26.
• [76] Hypersensitivity of ataxia-telangiectasia fibroblasts to a nitric oxide donor. Free Radic Biol Med. 1997;22(1-2):343-7. doi: 10.1016/s0891-5849(96)00336-x.