Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS88GSD)

• DOT Name: Latent-transforming growth factor beta-binding protein 2 (LTBP2)
• Synonyms: LTBP-2
• Gene Name: LTBP2
• Related Disease:
  Glaucoma 3, primary congenital, D
  Microspherophakia and/or megalocornea, with ectopia lentis and with or without secondary glaucoma
  Alzheimer disease
  Benign neoplasm
  Bone osteosarcoma
  Cardiac disease
  Cardiac failure
  Congestive heart failure
  Dilated cardiomyopathy
  Dilated cardiomyopathy 1A
  Esophageal squamous cell carcinoma
  Hepatitis
  Hepatitis A virus infection
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Isolated ectopia lentis
  Leiomyoma
  Melanoma
  Myocardial infarction
  Neoplasm
  Open-angle glaucoma
  OPTN-related open angle glaucoma
  Osteosarcoma
  Primary congenital glaucoma
  Thyroid gland carcinoma
  Uterine fibroids
  Weill-Marchesani 4 syndrome, recessive
  Meningioma
  Nasopharyngeal carcinoma
  Pulmonary emphysema
  Weill-Marchesani syndrome 3
  Congenital glaucoma
  Glaucoma secondary to spherophakia/ectopia lentis and megalocornea
  Weill-Marchesani syndrome
  Megalocornea
  Advanced cancer
  Colorectal carcinoma
  Gastric cancer
  Glaucoma/ocular hypertension
  Malignant mesothelioma
  Marfan syndrome
  Matthew-Wood syndrome
  Mesothelioma
  Pancreatic cancer
  Pancreatic ductal carcinoma
  Stomach cancer
• UniProt ID: LTBP2_HUMAN
• Pfam ID: PF00008 ; PF07645 ; PF00683
• Sequence:
  MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSY
  PAAAAAKVYSLFREQDAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVQPPAQ
  TRRSTPLGQQQPAPRTRAAPALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
  NSTNHCIKPVCEPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWA
  ERSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPPAGTLSGLSQTHPSQQHVGLSRTVRL
  HPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIVFTPTIC
  KQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPA
  NSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVHIHH
  PPEASVQIHQVAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPL
  PPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPV
  IENGQLECPQGYKRLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLMLDPSRSR
  CVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSRVGKAWGSECEKCPLPGTEAF
  REICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAERQPLRVVTDTW
  LEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTL
  STPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKG
  RCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGY
  IMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVC
  AHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACEN
  GYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECE
  DPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFF
  CLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDI
  DECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCD
  NTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYD
  AQEGHCRPRGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQ
  GASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNG
  RCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACENGECVNTEGSFHCFCSPPLTLD
  LSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQ
  CALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYL
  GPEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQAEECGIL
  NGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSY
  RCHCSPGYVAEAGPPHCTAKE
• Function: May play an integral structural role in elastic-fiber architectural organization and/or assembly.
• Tissue Specificity: Expressed in the aorta (at protein level). Expressed in lung, weakly expressed in heart, placenta, liver and skeletal muscle.
• Reactome Pathway:
  TGF-beta receptor signaling activates SMADs (R-HSA-2173789)
  Molecules associated with elastic fibres (R-HSA-2129379)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glaucoma 3, primary congenital, D	DISE3DJ5	Definitive	Autosomal recessive	[1]
Microspherophakia and/or megalocornea, with ectopia lentis and with or without secondary glaucoma	DISPDYFL	Definitive	Autosomal recessive	[2]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[3]
Benign neoplasm	DISDUXAD	Strong	Altered Expression	[4]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[5]
Cardiac disease	DISVO1I5	Strong	Altered Expression	[6]
Cardiac failure	DISDC067	Strong	Altered Expression	[7]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[7]
Dilated cardiomyopathy	DISX608J	Strong	Biomarker	[6]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[6]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[8]
Hepatitis	DISXXX35	Strong	Biomarker	[4]
Hepatitis A virus infection	DISUMFQV	Strong	Biomarker	[4]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[4]
Isolated ectopia lentis	DISJWTN6	Strong	Biomarker	[10]
Leiomyoma	DISLDDFN	Strong	Biomarker	[11]
Melanoma	DIS1RRCY	Strong	Biomarker	[12]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Open-angle glaucoma	DISSZEE8	Strong	Genetic Variation	[14]
OPTN-related open angle glaucoma	DISDR98A	Strong	Genetic Variation	[15]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[5]
Primary congenital glaucoma	DISY7HN4	Strong	Genetic Variation	[16]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[17]
Uterine fibroids	DISBZRMJ	Strong	Biomarker	[11]
Weill-Marchesani 4 syndrome, recessive	DISCL3SY	Strong	Genetic Variation	[14]
Meningioma	DISPT4TG	moderate	Biomarker	[18]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[19]
Pulmonary emphysema	DIS5M7HZ	moderate	Biomarker	[20]
Weill-Marchesani syndrome 3	DIS8RZZI	Moderate	Autosomal recessive	[21]
Congenital glaucoma	DISHN3GO	Supportive	Autosomal dominant	[22]
Glaucoma secondary to spherophakia/ectopia lentis and megalocornea	DISW4Q6R	Supportive	Autosomal recessive	[23]
Weill-Marchesani syndrome	DIS9B7CX	Supportive	Autosomal dominant	[24]
Megalocornea	DISIMNF0	Disputed	Genetic Variation	[25]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[26]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[27]
Gastric cancer	DISXGOUK	Limited	Biomarker	[28]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Genetic Variation	[14]
Malignant mesothelioma	DISTHJGH	Limited	Altered Expression	[29]
Marfan syndrome	DISVEUWZ	Limited	Biomarker	[10]
Matthew-Wood syndrome	DISA7HR7	Limited	Altered Expression	[26]
Mesothelioma	DISKWK9M	Limited	Altered Expression	[29]
Pancreatic cancer	DISJC981	Limited	Biomarker	[26]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Altered Expression	[26]
Stomach cancer	DISKIJSX	Limited	Biomarker	[28]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Latent-transforming growth factor beta-binding protein 2 (LTBP2) affects the response to substance of Paclitaxel.	[47]
Mitomycin	DMH0ZJE	Approved	Latent-transforming growth factor beta-binding protein 2 (LTBP2) affects the response to substance of Mitomycin.	[47]
Topotecan	DMP6G8T	Approved	Latent-transforming growth factor beta-binding protein 2 (LTBP2) affects the response to substance of Topotecan.	[47]
Vinblastine	DM5TVS3	Approved	Latent-transforming growth factor beta-binding protein 2 (LTBP2) affects the response to substance of Vinblastine.	[47]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[30]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[41]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[43]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[32]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[34]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[35]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[36]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[37]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[38]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[39]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[40]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[42]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[44]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[45]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Latent-transforming growth factor beta-binding protein 2 (LTBP2).	[46]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Loss of function mutations in the gene encoding latent transforming growth factor beta binding protein 2, LTBP2, cause primary congenital glaucoma. Hum Mol Genet. 2009 Oct 15;18(20):3969-77. doi: 10.1093/hmg/ddp338. Epub 2009 Aug 4.
• [3] Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.Nat Genet. 2011 May;43(5):436-41. doi: 10.1038/ng.801. Epub 2011 Apr 3.
• [4] Expression and clinical significance of latent-transforming growth factor beta-binding protein 2 in primary hepatocellular carcinoma.Medicine (Baltimore). 2019 Sep;98(39):e17216. doi: 10.1097/MD.0000000000017216.
• [5] miR-421 promotes apoptosis and suppresses metastasis of osteosarcoma cells via targeting LTBP2.J Cell Biochem. 2019 Jul;120(7):10978-10987. doi: 10.1002/jcb.28144. Epub 2019 Mar 28.
• [6] LTBP2 knockdown by siRNA reverses myocardial oxidative stress injury, fibrosis and remodelling during dilated cardiomyopathy.Acta Physiol (Oxf). 2020 Mar;228(3):e13377. doi: 10.1111/apha.13377. Epub 2019 Nov 6.
• [7] Genetic Regulation of Fibroblast Activation and Proliferation in Cardiac Fibrosis.Circulation. 2018 Sep 18;138(12):1224-1235. doi: 10.1161/CIRCULATIONAHA.118.035420.
• [8] The ECM protein LTBP-2 is a suppressor of esophageal squamous cell carcinoma tumor formation but higher tumor expression associates with poor patient outcome.Int J Cancer. 2011 Aug 1;129(3):565-73. doi: 10.1002/ijc.25698. Epub 2010 Nov 9.
• [9] Genetic variations in humans associated with differences in the course of hepatitis C.Biochem Biophys Res Commun. 2004 Apr 30;317(2):335-41. doi: 10.1016/j.bbrc.2004.03.056.
• [10] LTBP2 mutations cause Weill-Marchesani and Weill-Marchesani-like syndrome and affect disruptions in the extracellular matrix. Hum Mutat. 2012 Aug;33(8):1182-7. doi: 10.1002/humu.22105. Epub 2012 May 29.
• [11] Identification of genes with higher expression in human uterine leiomyomas than in the corresponding myometrium.Mol Hum Reprod. 2002 Mar;8(3):246-54. doi: 10.1093/molehr/8.3.246.
• [12] Latent transforming growth factor-beta-binding protein 2 is an adhesion protein for melanoma cells.J Biol Chem. 2003 Jul 4;278(27):24705-13. doi: 10.1074/jbc.M212953200. Epub 2003 Apr 25.
• [13] Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
• [14] Delineation of Novel Compound Heterozygous Variants in LTBP2 Associated with Juvenile Open Angle Glaucoma.Genes (Basel). 2018 Oct 30;9(11):527. doi: 10.3390/genes9110527.
• [15] Contribution of the latent transforming growth factor- binding protein 2 gene to etiology of primary open angle glaucoma and pseudoexfoliation syndrome.Mol Vis. 2013;19:333-47. Epub 2013 Feb 7.
• [16] Candidate Gene Analysis Identifies Mutations in CYP1B1 and LTBP2 in Indian Families with Primary Congenital Glaucoma.Genet Test Mol Biomarkers. 2017 Apr;21(4):252-258. doi: 10.1089/gtmb.2016.0203. Epub 2017 Feb 27.
• [17] Knockdown of Latent Transforming Growth Factor- (TGF-)-Binding Protein 2 (LTBP2) Inhibits Invasion and Tumorigenesis in Thyroid Carcinoma Cells.Oncol Res. 2017 Apr 14;25(4):503-510. doi: 10.3727/096504016X14755368915591. Epub 2016 Oct 5.
• [18] Genetic alterations associated with progression and recurrence in meningiomas.J Neuropathol Exp Neurol. 2012 Oct;71(10):882-93. doi: 10.1097/NEN.0b013e31826bf704.
• [19] LTBP-2 confers pleiotropic suppression and promotes dormancy in a growth factor permissive microenvironment in nasopharyngeal carcinoma.Cancer Lett. 2012 Dec 1;325(1):89-98. doi: 10.1016/j.canlet.2012.06.005. Epub 2012 Jun 26.
• [20] Latent TGF- binding protein 2 and 4 have essential overlapping functions in microfibril development.Sci Rep. 2017 Mar 2;7:43714. doi: 10.1038/srep43714.
• [21] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [22] Null mutations in LTBP2 cause primary congenital glaucoma. Am J Hum Genet. 2009 May;84(5):664-71. doi: 10.1016/j.ajhg.2009.03.017. Epub 2009 Apr 9.
• [23] LTBP2 null mutations in an autosomal recessive ocular syndrome with megalocornea, spherophakia, and secondary glaucoma. Eur J Hum Genet. 2010 Jul;18(7):761-7. doi: 10.1038/ejhg.2010.11. Epub 2010 Feb 24.
• [24] Weill-Marchesani Syndrome. 2007 Nov 1 [updated 2020 Dec 10]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [25] LTBP2-related "Marfan-like" phenotype in two Roma/Gypsy subjects with the LTBP2 homozygous p.R299X variant.Am J Med Genet A. 2019 Jan;179(1):104-112. doi: 10.1002/ajmg.a.10. Epub 2018 Dec 18.
• [26] Latent Transforming Growth Factor Binding Protein 2 (LTBP2) as a Novel Biomarker for the Diagnosis and Prognosis of Pancreatic Carcinoma.Med Sci Monit. 2017 Jul 3;23:3232-3239. doi: 10.12659/msm.905284.
• [27] High Expression of LTBP2 Contributes to Poor Prognosis in Colorectal Cancer Patients and Correlates with the Mesenchymal Colorectal Cancer Subtype.Dis Markers. 2019 Mar 10;2019:5231269. doi: 10.1155/2019/5231269. eCollection 2019.
• [28] LTBP2 promotes the migration and invasion of gastric cancer cells and predicts poor outcome of patients with gastric cancer.Int J Oncol. 2018 Jun;52(6):1886-1898. doi: 10.3892/ijo.2018.4356. Epub 2018 Apr 4.
• [29] Latent TGF- binding proteins (LTBPs) 1 and 3 differentially regulate transforming growth factor- activity in malignant mesothelioma.Hum Pathol. 2011 Feb;42(2):269-78. doi: 10.1016/j.humpath.2010.07.005. Epub 2010 Nov 24.
• [30] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [31] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [34] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [35] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [36] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [37] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [38] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [39] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [40] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [41] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [42] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [43] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [46] Drug development for ovarian hyper-stimulation and anti-cancer treatment: blocking of gonadotropin signaling for epiregulin and amphiregulin biosynthesis. Biochem Pharmacol. 2004 Sep 15;68(6):989-96. doi: 10.1016/j.bcp.2004.05.027.
• [47] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.