Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSFVC82)

• DOT Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B)
• Synonyms: PP2A subunit B isoform B55-beta; PP2A subunit B isoform PR55-beta; PP2A subunit B isoform R2-beta; PP2A subunit B isoform beta
• Gene Name: PPP2R2B
• Related Disease:
  Nervous system disease
  Alzheimer disease
  Blast phase chronic myelogenous leukemia, BCR-ABL1 positive
  Breast cancer
  Breast carcinoma
  Cardiac arrest
  Cerebellar ataxia
  Dentatorubral-pallidoluysian atrophy
  Depression
  Ductal breast carcinoma in situ
  Essential tremor
  Fragile X-associated tremor/ataxia syndrome
  Friedreich's ataxia
  Lung cancer
  Lung carcinoma
  Mental disorder
  Parkinson disease
  Spinocerebellar ataxia
  Spinocerebellar ataxia type 12
  Autoimmune disease
  Bone osteosarcoma
  Dementia
  Myotonic dystrophy type 2
  Osteosarcoma
  Autosomal dominant cerebellar ataxia type II
  Colorectal carcinoma
  Hereditary episodic ataxia
  Huntington disease-like 2
  Nasopharyngeal carcinoma
  Neuroblastoma
  Spinocerebellar ataxia type 1
  Spinocerebellar ataxia type 2
  Spinocerebellar ataxia type 5
  Spinocerebellar ataxia type 6
• UniProt ID: 2ABB_HUMAN
• Sequence:
  MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
  VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV
  SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS
  VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY
  SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
  YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN
  FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
  HPSENIIAVAATNNLYIFQDKVN
• Function: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is required to promote proapoptotic activity. Isoform 2 regulates neuronal survival through the mitochondrial fission and fusion balance.
• Tissue Specificity: Brain.
• KEGG Pathway:
  mR. surveillance pathway (hsa03015)
  Sphingolipid sig.ling pathway (hsa04071)
  PI3K-Akt sig.ling pathway (hsa04151)
  AMPK sig.ling pathway (hsa04152)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Hippo sig.ling pathway (hsa04390)
  Tight junction (hsa04530)
  T cell receptor sig.ling pathway (hsa04660)
  Dopaminergic sy.pse (hsa04728)
  Chagas disease (hsa05142)
  Hepatitis C (hsa05160)
  Human papillomavirus infection (hsa05165)

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Nervous system disease	DISJ7GGT	Definitive	Genetic Variation	[1]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[2]
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive	DIS3KLUX	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Cardiac arrest	DIS9DIA4	Strong	Genetic Variation	[5]
Cerebellar ataxia	DIS9IRAV	Strong	Genetic Variation	[6]
Dentatorubral-pallidoluysian atrophy	DISHWE0K	Strong	Biomarker	[7]
Depression	DIS3XJ69	Strong	Biomarker	[8]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Posttranslational Modification	[9]
Essential tremor	DIS7GBKQ	Strong	Genetic Variation	[10]
Fragile X-associated tremor/ataxia syndrome	DISKB25R	Strong	Biomarker	[6]
Friedreich's ataxia	DIS5DV35	Strong	Genetic Variation	[11]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[12]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[12]
Mental disorder	DIS3J5R8	Strong	Biomarker	[10]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[10]
Spinocerebellar ataxia	DISYMHUK	Strong	Genetic Variation	[13]
Spinocerebellar ataxia type 12	DISFJ7OA	Strong	Autosomal dominant	[14]
Autoimmune disease	DISORMTM	moderate	Altered Expression	[15]
Bone osteosarcoma	DIST1004	moderate	Altered Expression	[16]
Dementia	DISXL1WY	moderate	Genetic Variation	[17]
Myotonic dystrophy type 2	DIS5ZWF1	moderate	Biomarker	[18]
Osteosarcoma	DISLQ7E2	moderate	Altered Expression	[16]
Autosomal dominant cerebellar ataxia type II	DIS0PM39	Limited	Biomarker	[19]
Colorectal carcinoma	DIS5PYL0	Limited	Posttranslational Modification	[20]
Hereditary episodic ataxia	DISC4ZQW	Limited	Biomarker	[21]
Huntington disease-like 2	DISM3G09	Limited	Genetic Variation	[22]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Altered Expression	[23]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[10]
Spinocerebellar ataxia type 1	DISF7BO2	Limited	Biomarker	[19]
Spinocerebellar ataxia type 2	DISF7WDI	Limited	Biomarker	[19]
Spinocerebellar ataxia type 5	DISPYXJ0	Limited	Biomarker	[19]
Spinocerebellar ataxia type 6	DISH7224	Limited	Biomarker	[22]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[24]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[25]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[27]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[28]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[29]
Zoledronate	DMIXC7G	Approved	Zoledronate affects the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[30]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[31]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[32]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[33]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[34]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[36]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[37]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[35]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[31]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[39]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B).	[38]

References

• [1] Generation of three spinocerebellar ataxia type-12 patients derived induced pluripotent stem cell lines (IGIBi002-A, IGIBi003-A and IGIBi004-A).Stem Cell Res. 2018 Aug;31:216-221. doi: 10.1016/j.scr.2018.08.008. Epub 2018 Aug 14.
• [2] Association between CAG repeat length in the PPP2R2B gene and Alzheimer disease in the Japanese population.Neurosci Lett. 2011 Jan 10;487(3):354-7. doi: 10.1016/j.neulet.2010.10.055. Epub 2010 Oct 26.
• [3] The tumor suppressor PP2A is functionally inactivated in blast crisis CML through the inhibitory activity of the BCR/ABL-regulated SET protein.Cancer Cell. 2005 Nov;8(5):355-68. doi: 10.1016/j.ccr.2005.10.015.
• [4] Germline variation in TP53 regulatory network genes associates with breast cancer survival and treatment outcome.Int J Cancer. 2013 May 1;132(9):2044-55. doi: 10.1002/ijc.27884. Epub 2012 Oct 25.
• [5] SCA-LSVD: a repeat-oriented locus-specific variation database for genotype to phenotype correlations in spinocerebellar ataxias.Hum Mutat. 2009 Jul;30(7):1037-42. doi: 10.1002/humu.21006.
• [6] Identification of FXTAS presenting with SCA 12 like phenotype in India.Parkinsonism Relat Disord. 2014 Oct;20(10):1089-93. doi: 10.1016/j.parkreldis.2014.07.001. Epub 2014 Jul 17.
• [7] Genetic screening of Greek patients with Huntingtons disease phenocopies identifies an SCA8 expansion.J Neurol. 2012 Sep;259(9):1874-8. doi: 10.1007/s00415-012-6430-9.
• [8] Spinocerebellar ataxia type 12.Handb Clin Neurol. 2012;103:535-47. doi: 10.1016/B978-0-444-51892-7.00034-6.
• [9] Frequent aberrant DNA methylation of ABCB1, FOXC1, PPP2R2B and PTEN in ductal carcinoma in situ and early invasive breast cancer. Breast Cancer Res. 2010;12(1):R3.
• [10] PPP2R2B CAG repeat length in the Han Chinese in Taiwan: Association analyses in neurological and psychiatric disorders and potential functional implications.Am J Med Genet B Neuropsychiatr Genet. 2009 Jan 5;150B(1):124-9. doi: 10.1002/ajmg.b.30785.
• [11] Detection of large pathogenic expansions in FRDA1, SCA10, and SCA12 genes using a simple fluorescent repeat-primed PCR assay.J Mol Diagn. 2004 May;6(2):96-100. doi: 10.1016/S1525-1578(10)60496-5.
• [12] Association analyses identify multiple new lung cancer susceptibility loci and their interactions with smoking in the Chinese population.Nat Genet. 2012 Jul 15;44(8):895-9. doi: 10.1038/ng.2351.
• [13] Mapping of autosomal dominant cerebellar ataxia without the pathogenic PPP2R2B mutation to the locus for spinocerebellar ataxia 12.Arch Neurol. 2010 Oct;67(10):1257-62. doi: 10.1001/archneurol.2010.231.
• [14] Expansion of a novel CAG trinucleotide repeat in the 5' region of PPP2R2B is associated with SCA12. Nat Genet. 1999 Dec;23(4):391-2. doi: 10.1038/70493.
• [15] PPP2R2B hypermethylation causes acquired apoptosis deficiency in systemic autoimmune diseases.JCI Insight. 2019 Jul 23;5(16):e126457. doi: 10.1172/jci.insight.126457.
• [16] Identification of differentially expressed genes in the development of osteosarcoma using RNA-seq.Oncotarget. 2016 Dec 27;7(52):87194-87205. doi: 10.18632/oncotarget.13554.
• [17] SCA-12: Tremor with cerebellar and cortical atrophy is associated with a CAG repeat expansion.Neurology. 2001 Feb 13;56(3):299-303. doi: 10.1212/wnl.56.3.299.
• [18] RNA-mediated neuromuscular disorders.Annu Rev Neurosci. 2006;29:259-77. doi: 10.1146/annurev.neuro.29.051605.113014.
• [19] The spinocerebellar ataxia 12 gene product and protein phosphatase 2A regulatory subunit Bbeta2 antagonizes neuronal survival by promoting mitochondrial fission.J Biol Chem. 2008 Dec 26;283(52):36241-8. doi: 10.1074/jbc.M800989200. Epub 2008 Oct 21.
• [20] B55-associated PP2A complex controls PDK1-directed myc signaling and modulates rapamycin sensitivity in colorectal cancer.Cancer Cell. 2010 Nov 16;18(5):459-71. doi: 10.1016/j.ccr.2010.10.021.
• [21] PTPRR, cerebellum, and motor coordination.Cerebellum. 2009 Jun;8(2):71-3. doi: 10.1007/s12311-009-0118-4.
• [22] Trinucleotide repeat disorders.Handb Clin Neurol. 2017;145:383-391. doi: 10.1016/B978-0-12-802395-2.00027-4.
• [23] Inhibition of DNA methyltransferase as a novel therapeutic strategy to overcome acquired resistance to dual PI3K/mTOR inhibitors.Oncotarget. 2015 Mar 10;6(7):5134-46. doi: 10.18632/oncotarget.3016.
• [24] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [25] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [26] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [29] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [30] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [31] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [32] Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
• [33] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [34] Effects of metformin and pioglitazone combination on apoptosis and AMPK/mTOR signaling pathway in human anaplastic thyroid cancer cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22547. doi: 10.1002/jbt.22547. Epub 2020 Jun 26.
• [35] Caffeine overcomes genistein-induced G2/M cell cycle arrest in breast cancer cells. Nutr Cancer. 2008;60(3):382-8.
• [36] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [37] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [38] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [39] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.