Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTRK9XN)

• DOT Name: Hepatic leukemia factor (HLF)
• Gene Name: HLF
• Related Disease:
  Non-insulin dependent diabetes
  Acute monocytic leukemia
  Acute myelogenous leukaemia
  Acute undifferentiated leukemia
  Advanced cancer
  Childhood acute lymphoblastic leukemia
  Gout
  Hepatitis B virus infection
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Kidney failure
  leukaemia
  Leukemia
  Major depressive disorder
  Neoplasm
  Pulmonary fibrosis
  Retinoblastoma
  Burkitt lymphoma
  Bipolar disorder
  Carcinoma of liver and intrahepatic biliary tract
  Hypercalcaemia
  Liver cancer
  Parkinson disease
• UniProt ID: HLF_HUMAN
• Pfam ID: PF07716
• Sequence:
  MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVP
  QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA
  PSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA
  DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAK
  RSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
• Tissue Specificity: Highly expressed in liver; lower levels in lung and kidney.

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[1]
Acute monocytic leukemia	DIS28NEL	Strong	Biomarker	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Acute undifferentiated leukemia	DISJ4SSG	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[4]
Gout	DISHC0U7	Strong	Genetic Variation	[5]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[6]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[8]
Kidney failure	DISOVQ9P	Strong	Biomarker	[9]
leukaemia	DISS7D1V	Strong	Biomarker	[10]
Leukemia	DISNAKFL	Strong	Biomarker	[10]
Major depressive disorder	DIS4CL3X	Strong	Altered Expression	[11]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[12]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[13]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[14]
Burkitt lymphoma	DIS9D5XU	moderate	FusionGene	[15]
Bipolar disorder	DISAM7J2	Limited	Genetic Variation	[16]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[17]
Hypercalcaemia	DISKQ2K7	Limited	Genetic Variation	[9]
Liver cancer	DISDE4BI	Limited	Biomarker	[17]
Parkinson disease	DISQVHKL	Limited	Biomarker	[18]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Uric acid	DMA1MKT	Investigative	Hepatic leukemia factor (HLF) affects the abundance of Uric acid.	[5]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Hepatic leukemia factor (HLF).	[19]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Hepatic leukemia factor (HLF).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Hepatic leukemia factor (HLF).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Hepatic leukemia factor (HLF).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Hepatic leukemia factor (HLF).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Hepatic leukemia factor (HLF).	[24]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Hepatic leukemia factor (HLF).	[20]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Hepatic leukemia factor (HLF).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Hepatic leukemia factor (HLF).	[26]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Hepatic leukemia factor (HLF).	[26]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Hepatic leukemia factor (HLF).	[27]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Hepatic leukemia factor (HLF).	[28]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Hepatic leukemia factor (HLF).	[29]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Hepatic leukemia factor (HLF).	[30]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Hepatic leukemia factor (HLF).	[31]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Hepatic leukemia factor (HLF).	[30]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Hepatic leukemia factor (HLF).	[34]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Hepatic leukemia factor (HLF).	[35]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Hepatic leukemia factor (HLF).	[36]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Hepatic leukemia factor (HLF).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Hepatic leukemia factor (HLF).	[33]

References

• [1] Healthy lifestyle and normal waist circumference are associated with a lower 5-year risk of type 2 diabetes in middle-aged and elderly individuals: Results from the healthy aging longitudinal study in Taiwan (HALST).Medicine (Baltimore). 2017 Feb;96(6):e6025. doi: 10.1097/MD.0000000000006025.
• [2] Hepatic leukemia factor is a novel leukemic stem cell regulator in DNMT3A, NPM1, and FLT3-ITD triple-mutated AML.Blood. 2019 Jul 18;134(3):263-276. doi: 10.1182/blood.2018862383. Epub 2019 May 10.
• [3] HLF/miR-132/TTK axis regulates cell proliferation, metastasis and radiosensitivity of glioma cells.Biomed Pharmacother. 2016 Oct;83:898-904. doi: 10.1016/j.biopha.2016.08.004. Epub 2016 Aug 10.
• [4] NGS-based methylation profiling differentiates TCF3-HLF and TCF3-PBX1 positive B-cell acute lymphoblastic leukemia.Epigenomics. 2018 Feb;10(2):133-147. doi: 10.2217/epi-2017-0080. Epub 2018 Jan 15.
• [5] Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.
• [6] Expression of oncogenes and tumor suppressor genes in human hepatocellular carcinoma and hepatoblastoma cell lines.J Med Virol. 1992 Dec;38(4):235-9. doi: 10.1002/jmv.1890380402.
• [7] The intracellular inhibition of HCV replication represents a novel mechanism of action by the innate immune Lactoferrin protein.Antiviral Res. 2014 Nov;111:13-22. doi: 10.1016/j.antiviral.2014.08.012. Epub 2014 Sep 1.
• [8] Survival pathway of cholangiocarcinoma via AKT/mTOR signaling to escape RAF/MEK/ERK pathway inhibition by sorafenib.Oncol Rep. 2018 Feb;39(2):843-850. doi: 10.3892/or.2017.6153. Epub 2017 Dec 13.
• [9] Hypercalcemia in childhood acute lymphoblastic leukemia: frequent implication of parathyroid hormone-related peptide and E2A-HLF from translocation 17;19.Leukemia. 2007 Feb;21(2):288-96. doi: 10.1038/sj.leu.2404496. Epub 2006 Dec 21.
• [10] The Leukemogenic TCF3-HLF Complex Rewires Enhancers Driving Cellular Identity and Self-Renewal Conferring EP300 Vulnerability.Cancer Cell. 2019 Dec 9;36(6):630-644.e9. doi: 10.1016/j.ccell.2019.10.004. Epub 2019 Nov 14.
• [11] Differential co-expression and regulation analyses reveal different mechanisms underlying major depressive disorder and subsyndromal symptomatic depression.BMC Bioinformatics. 2015 Apr 3;16:112. doi: 10.1186/s12859-015-0543-y.
• [12] Identification of cooperative genes for E2A-PBX1 to develop acute lymphoblastic leukemia.Cancer Sci. 2016 Jul;107(7):890-8. doi: 10.1111/cas.12945. Epub 2016 Jun 13.
• [13] Protocatechuic aldehyde ameliorates experimental pulmonary fibrosis by modulating HMGB1/RAGE pathway.Toxicol Appl Pharmacol. 2015 Feb 15;283(1):50-6. doi: 10.1016/j.taap.2015.01.001. Epub 2015 Jan 9.
• [14] Involvement of p21(WAF1/Cip1), p27(Kip1), and p18(INK4c) in troglitazone-induced cell-cycle arrest in human hepatoma cell lines.Hepatology. 2001 May;33(5):1087-97. doi: 10.1053/jhep.2001.24024.
• [15] Aberrant induction of LMO2 by the E2A-HLF chimeric transcription factor and its implication in leukemogenesis of B-precursor ALL with t(17;19).Blood. 2010 Aug 12;116(6):962-70. doi: 10.1182/blood-2009-09-244673. Epub 2010 Jun 2.
• [16] Genome-wide association study identifies 30 loci associated with bipolar disorder.Nat Genet. 2019 May;51(5):793-803. doi: 10.1038/s41588-019-0397-8. Epub 2019 May 1.
• [17] Suppression of Lefty expression in induced pluripotent cancer cells.FASEB J. 2013 Jun;27(6):2165-74. doi: 10.1096/fj.12-221432. Epub 2013 Feb 13.
• [18] Gene expression profiling combined with bioinformatics analysis identify biomarkers for Parkinson disease.PLoS One. 2012;7(12):e52319. doi: 10.1371/journal.pone.0052319. Epub 2012 Dec 28.
• [19] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [20] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [21] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [22] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [25] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [26] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [27] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [28] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [29] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [30] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [31] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [32] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [33] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [34] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [35] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [36] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
• [37] Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.