Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUXL0HC)

DOT Name GTP-binding protein REM 1 (REM1)
Synonyms GTPase-regulating endothelial cell sprouting; Rad and Gem-like GTP-binding protein 1
Gene Name REM1
Related Disease
Mood disorder ( )
Acute myelogenous leukaemia ( )
Adenocarcinoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Attention deficit hyperactivity disorder ( )
B-cell neoplasm ( )
Bipolar disorder ( )
Breast cancer ( )
Breast carcinoma ( )
Cardiovascular disease ( )
Cervical cancer ( )
Cervical carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Dementia ( )
Ehlers-Danlos syndrome ( )
Endometriosis ( )
Epilepsy ( )
Gastric adenocarcinoma ( )
Gastritis ( )
Hypersomnia ( )
Insomnia ( )
Irritable bowel syndrome ( )
Major depressive disorder ( )
Myocardial infarction ( )
Myotonic dystrophy ( )
Narcolepsy ( )
Neoplasm ( )
Obstructive sleep apnea ( )
Pancreatic cancer ( )
Parkinson disease ( )
Post-traumatic stress disorder ( )
Schizophrenia ( )
Smith-Magenis syndrome ( )
Stroke ( )
High blood pressure ( )
Narcolepsy type 1 ( )
Sleep disorder ( )
Ankylosing spondylitis ( )
Anxiety disorder ( )
Lewy body dementia ( )
Mental disorder ( )
Non-insulin dependent diabetes ( )
Parkinsonian disorder ( )
Psychotic disorder ( )
Rheumatoid arthritis ( )
UniProt ID
REM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2NZJ
Pfam ID
PF00071
Sequence
MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPS
PAPDDWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT
LTVDGEDTTLVVVDTWEAEKLDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLR
RTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVV
RQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVL
Function Promotes endothelial cell sprouting and actin cytoskeletal reorganization. May be involved in angiogenesis. May function in Ca(2+) signaling.
Tissue Specificity
Most highly expressed in the endothelial lining of the blood vessels in uterus and heart. Lower levels found in spleen, lymph node, kidney and testis. Also found in cells with secretory function such as the islets of Langerhans, lobule/duct epithelium in the breast, bile duct epithelium in the liver, surface epithelium in the endometrial glands of the uterus, colon mucosa and acinar cells in the pancreas and the prostate.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Mood disorder DISLVMWO Definitive Biomarker [1]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [2]
Adenocarcinoma DIS3IHTY Strong Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Alzheimer disease DISF8S70 Strong Genetic Variation [5]
Attention deficit hyperactivity disorder DISL8MX9 Strong Biomarker [6]
B-cell neoplasm DISVY326 Strong Altered Expression [7]
Bipolar disorder DISAM7J2 Strong Biomarker [6]
Breast cancer DIS7DPX1 Strong Biomarker [8]
Breast carcinoma DIS2UE88 Strong Biomarker [8]
Cardiovascular disease DIS2IQDX Strong Biomarker [9]
Cervical cancer DISFSHPF Strong Biomarker [8]
Cervical carcinoma DIST4S00 Strong Biomarker [8]
Colon cancer DISVC52G Strong Biomarker [8]
Colon carcinoma DISJYKUO Strong Biomarker [8]
Dementia DISXL1WY Strong Biomarker [10]
Ehlers-Danlos syndrome DISSVBRR Strong Genetic Variation [11]
Endometriosis DISX1AG8 Strong Biomarker [12]
Epilepsy DISBB28L Strong Biomarker [13]
Gastric adenocarcinoma DISWWLTC Strong Altered Expression [14]
Gastritis DIS8G07K Strong Biomarker [15]
Hypersomnia DISKYOM6 Strong Biomarker [16]
Insomnia DIS0AFR7 Strong Altered Expression [17]
Irritable bowel syndrome DIS27206 Strong Biomarker [18]
Major depressive disorder DIS4CL3X Strong Altered Expression [19]
Myocardial infarction DIS655KI Strong Biomarker [20]
Myotonic dystrophy DISNBEMX Strong Biomarker [21]
Narcolepsy DISLCNLI Strong Biomarker [22]
Neoplasm DISZKGEW Strong Altered Expression [23]
Obstructive sleep apnea DIS0SVD1 Strong Biomarker [24]
Pancreatic cancer DISJC981 Strong Biomarker [25]
Parkinson disease DISQVHKL Strong Genetic Variation [26]
Post-traumatic stress disorder DISHL1EY Strong Altered Expression [27]
Schizophrenia DISSRV2N Strong Genetic Variation [5]
Smith-Magenis syndrome DISG4G6X Strong Biomarker [28]
Stroke DISX6UHX Strong Genetic Variation [29]
High blood pressure DISY2OHH moderate Biomarker [30]
Narcolepsy type 1 DISH7Y6Q moderate Genetic Variation [31]
Sleep disorder DIS3JP1U moderate Biomarker [32]
Ankylosing spondylitis DISRC6IR Limited Biomarker [33]
Anxiety disorder DISBI2BT Limited Genetic Variation [34]
Lewy body dementia DISAE66J Limited Biomarker [35]
Mental disorder DIS3J5R8 Limited Biomarker [36]
Non-insulin dependent diabetes DISK1O5Z Limited Genetic Variation [37]
Parkinsonian disorder DISHGY45 Limited Biomarker [38]
Psychotic disorder DIS4UQOT Limited Biomarker [39]
Rheumatoid arthritis DISTSB4J Limited Biomarker [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Folic acid DMEMBJC Approved Folic acid increases the expression of GTP-binding protein REM 1 (REM1). [40]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of GTP-binding protein REM 1 (REM1). [42]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of GTP-binding protein REM 1 (REM1). [41]
------------------------------------------------------------------------------------

References

1 Sleep study in Disruptive Mood Dysregulation Disorder and Bipolar children.Actas Esp Psiquiatr. 2017 Jan;45(1):12-20. Epub 2017 Jan 1.
2 SOCS2 is part of a highly prognostic 4-gene signature in AML and promotes disease aggressiveness.Sci Rep. 2019 Jun 24;9(1):9139. doi: 10.1038/s41598-019-45579-0.
3 Overexpressed MALAT1 promotes invasion and metastasis of gastric cancer cells via increasing EGFL7 expression.Life Sci. 2016 Jul 15;157:38-44. doi: 10.1016/j.lfs.2016.05.041. Epub 2016 May 31.
4 MT1MMP promotes the proliferation and invasion of gastric carcinoma cells via regulating vimentin and Ecadherin.Mol Med Rep. 2019 Apr;19(4):2519-2526. doi: 10.3892/mmr.2019.9918. Epub 2019 Jan 31.
5 Disturbances of sleep quality, timing and structure and their relationship with other neuropsychiatric symptoms in Alzheimer's disease and schizophrenia: Insights from studies in patient populations and animal models.Neurosci Biobehav Rev. 2019 Feb;97:112-137. doi: 10.1016/j.neubiorev.2018.09.027. Epub 2018 Oct 9.
6 Sleep alterations in pediatric bipolar disorder versus attention deficit disorder.Psychiatry Res. 2019 May;275:39-45. doi: 10.1016/j.psychres.2019.01.108. Epub 2019 Mar 7.
7 Theaflavins attenuate ethanolinduced oxidative stress and cell apoptosis in gastric mucosa epithelial cells via downregulation of the mitogenactivated protein kinase pathway.Mol Med Rep. 2018 Oct;18(4):3791-3799. doi: 10.3892/mmr.2018.9352. Epub 2018 Aug 3.
8 Synthesis and Anticancer Activity Evaluation of Hydrolyzed Derivatives of Panaxnotoginseng Saponins.Molecules. 2018 Nov 19;23(11):3021. doi: 10.3390/molecules23113021.
9 Obstructive Sleep Apnea during REM Sleep and Cardiovascular Disease.Am J Respir Crit Care Med. 2018 Mar 1;197(5):653-660. doi: 10.1164/rccm.201706-1112OC.
10 Short Average Duration of NREM/REM Cycle Is Related to Cognitive Decline in an Elderly Cohort: An Exploratory Investigation.J Alzheimers Dis. 2019;70(4):1123-1132. doi: 10.3233/JAD-190399.
11 Excessive daytime sleepiness and fatigue in neurological disorders.Sleep Breath. 2020 Jun;24(2):413-424. doi: 10.1007/s11325-019-01921-4. Epub 2019 Aug 23.
12 Evaluation of Efficacy and Safety of Dan'e-Fukang Soft Extract in the Treatment of Endometriosis: A Meta-Analysis of 39 Randomized Controlled Trials Enrolling 5442 Patients.Evid Based Complement Alternat Med. 2017;2017:9767391. doi: 10.1155/2017/9767391. Epub 2017 Feb 27.
13 Video polysomnographic findings in non-rapid eye movement parasomnia.J Sleep Res. 2019 Apr;28(2):e12772. doi: 10.1111/jsr.12772. Epub 2018 Oct 8.
14 Long noncoding RNA RP1?63G9.1 is downregulated in gastric adenocarcinoma and is associated with a poor prognosis.Oncol Rep. 2019 Jun;41(6):3575-3585. doi: 10.3892/or.2019.7127. Epub 2019 Apr 17.
15 Inflammatory responses induced by Helicobacter pylori on the carcinogenesis of gastric epithelial GES? cells.Int J Oncol. 2019 Jun;54(6):2200-2210. doi: 10.3892/ijo.2019.4775. Epub 2019 Apr 9.
16 Secondary hypersomnia as an initial manifestation of neuromyelitis optica spectrum disorders.Mult Scler Relat Disord. 2020 Feb;38:101869. doi: 10.1016/j.msard.2019.101869. Epub 2019 Nov 25.
17 Brain-derived neurotrophic factor is a biomarker for subjective insomnia but not objectively assessable poor sleep continuity.J Psychiatr Res. 2019 Mar;110:103-109. doi: 10.1016/j.jpsychires.2018.12.020. Epub 2019 Jan 4.
18 Pharmacological treatments for functional nausea and functional dyspepsia in children: a systematic review.Expert Rev Clin Pharmacol. 2018 Dec;11(12):1195-1208. doi: 10.1080/17512433.2018.1540298. Epub 2018 Dec 6.
19 The 'affect tagging and consolidation' (ATaC) model of depression vulnerability.Neurobiol Learn Mem. 2017 Apr;140:43-51. doi: 10.1016/j.nlm.2017.02.003. Epub 2017 Feb 15.
20 Gene Expression Profiles Link Respiratory Viral Infection, Platelet Response to Aspirin, and Acute Myocardial Infarction.PLoS One. 2015 Jul 20;10(7):e0132259. doi: 10.1371/journal.pone.0132259. eCollection 2015.
21 Muscleblind-like 2-mediated alternative splicing in the developing brain and dysregulation in myotonic dystrophy.Neuron. 2012 Aug 9;75(3):437-50. doi: 10.1016/j.neuron.2012.05.029.
22 Nocturnal REM Sleep Without Atonia Is a Diagnostic Biomarker of Pediatric Narcolepsy.J Clin Sleep Med. 2018 Feb 15;14(2):245-252. doi: 10.5664/jcsm.6944.
23 Helicobacter pylori CagA promotes the malignant transformation of gastric mucosal epithelial cells through the dysregulation of the miR-155/KLF4 signaling pathway.Mol Carcinog. 2019 Aug;58(8):1427-1437. doi: 10.1002/mc.23025. Epub 2019 Jun 4.
24 REM sleep and sleep apnea are associated with language function in Down syndrome children: An analysis of a community sample.J Formos Med Assoc. 2020 Jan;119(1 Pt 3):516-523. doi: 10.1016/j.jfma.2019.07.015. Epub 2019 Aug 1.
25 Brucein D, a Naturally Occurring Tetracyclic Triterpene Quassinoid, Induces Apoptosis in Pancreatic Cancer through ROS-Associated PI3K/Akt Signaling Pathway.Front Pharmacol. 2017 Dec 22;8:936. doi: 10.3389/fphar.2017.00936. eCollection 2017.
26 Comparison of Quantitative Electroencephalogram During Sleep in Depressed and Non-Depressed Patients with Parkinson's Disease.Med Sci Monit. 2019 Feb 7;25:1046-1052. doi: 10.12659/MSM.913931.
27 REM theta activity predicts re-experiencing symptoms after exposure to a traumatic film.Sleep Med. 2019 Feb;54:142-152. doi: 10.1016/j.sleep.2018.10.030. Epub 2018 Nov 19.
28 Hypoventilation in REM sleep in a case of 17p11.2 deletion (Smith-Magenis syndrome).Am J Med Genet A. 2010 Mar;152A(3):708-12. doi: 10.1002/ajmg.a.32700.
29 The estimation of excessive daytime sleepiness in post-stroke patients - a polysomnographic study.Respir Physiol Neurobiol. 2019 Sep;267:1-5. doi: 10.1016/j.resp.2019.05.013. Epub 2019 May 25.
30 Effect of psychostimulants on blood pressure profile and endothelial function in narcolepsy.Neurology. 2018 Feb 6;90(6):e479-e491. doi: 10.1212/WNL.0000000000004911. Epub 2018 Jan 10.
31 The link between narcolepsy and autonomic cardiovascular dysfunction: a translational perspective.Clin Auton Res. 2018 Dec;28(6):545-555. doi: 10.1007/s10286-017-0473-z. Epub 2017 Oct 10.
32 Chronic sleep fragmentation enhances habenula cholinergic neural activity.Mol Psychiatry. 2021 Mar;26(3):941-954. doi: 10.1038/s41380-019-0419-z. Epub 2019 Apr 12.
33 Subjective Complaints as the Main Reason for Biosimilar Discontinuation After Open-Label Transition From Reference Infliximab to Biosimilar Infliximab.Arthritis Rheumatol. 2018 Jan;70(1):60-68. doi: 10.1002/art.40324. Epub 2017 Dec 7.
34 Subthreshold depressions: clinical and polysomnographic validation of dysthymic, residual and masked forms.J Affect Disord. 1997 Aug;45(1-2):53-63. doi: 10.1016/s0165-0327(97)00059-1.
35 REM sleep without atonia as prodromal marker of Lewy body disease: Fake news or the real deal?.Parkinsonism Relat Disord. 2019 Oct;67:34-35. doi: 10.1016/j.parkreldis.2019.09.017. Epub 2019 Sep 16.
36 Early diagnosis of Lewy body disease in patients with late-onset psychiatric disorders using clinical history of rapid eye movement sleep behavior disorder and [(123) I]-metaiodobenzylguanidine cardiac scintigraphy.Psychiatry Clin Neurosci. 2018 Jun;72(6):423-434. doi: 10.1111/pcn.12651. Epub 2018 Apr 10.
37 Association of rs734312 and rs10010131 polymorphisms in WFS1 gene with type 2 diabetes mellitus: a meta-analysis.Endocr J. 2013;60(4):441-7. Epub 2012 Dec 15.
38 Clinical Significance of REM Sleep Behavior Disorders and Other Non-motor Symptoms of Parkinsonism.Neurosci Bull. 2017 Oct;33(5):576-584. doi: 10.1007/s12264-017-0164-8. Epub 2017 Aug 3.
39 EEG 40 Hz Coherence Decreases in REM Sleep and Ketamine Model of Psychosis.Front Psychiatry. 2019 Jan 17;9:766. doi: 10.3389/fpsyt.2018.00766. eCollection 2018.
40 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
41 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
42 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.