Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWRFTIB)

• DOT Name: Fructose-bisphosphate aldolase A (ALDOA)
• Synonyms: EC 4.1.2.13; Lung cancer antigen NY-LU-1; Muscle-type aldolase
• Gene Name: ALDOA
• Related Disease:
  Glycogen storage disease due to aldolase A deficiency
  Advanced cancer
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cholangiocarcinoma
  Disorder of glycogen metabolism
  Ductal carcinoma
  Hemolytic anemia
  Hereditary haemolytic anemia
  Lung adenocarcinoma
  Myocardial ischemia
  Neoplasm
  Obstructive sleep apnea
  Osteoarthritis
  Osteosarcoma
  Rhegmatogenous retinal detachment
  Spondyloarthropathy
  Carcinoma
  Clear cell renal carcinoma
  Renal cell carcinoma
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Pancreatic cancer
• UniProt ID: ALDOA_HUMAN
• PDB ID: 1ALD; 2ALD; 4ALD; 5KY6; 6XMH; 6XML; 6XMM; 6XMO
• EC Number: 4.1.2.13
• Pfam ID: PF00274
• Sequence:
  MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
  QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
  GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
  NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
  TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
  SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS
  NHAY
• Function: Catalyzes the reversible conversion of beta-D-fructose 1,6-bisphosphate (FBP) into two triose phosphate and plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein.
• KEGG Pathway:
  Glycolysis / Gluconeogenesis (hsa00010)
  Pentose phosphate pathway (hsa00030)
  Fructose and mannose metabolism (hsa00051)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Biosynthesis of amino acids (hsa01230)
  HIF-1 sig.ling pathway (hsa04066)
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Glycolysis (R-HSA-70171)
  Gluconeogenesis (R-HSA-70263)
  Platelet degranulation (R-HSA-114608)
• BioCyc Pathway: MetaCyc:HS07647-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glycogen storage disease due to aldolase A deficiency	DISTYB67	Definitive	Autosomal recessive	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[4]
Cholangiocarcinoma	DIS71F6X	Strong	Altered Expression	[5]
Disorder of glycogen metabolism	DISYGNOB	Strong	Biomarker	[6]
Ductal carcinoma	DIS15EA5	Strong	Altered Expression	[5]
Hemolytic anemia	DIS803XQ	Strong	Genetic Variation	[7]
Hereditary haemolytic anemia	DIS487SI	Strong	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[8]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[9]
Neoplasm	DISZKGEW	Strong	Biomarker	[10]
Obstructive sleep apnea	DIS0SVD1	Strong	Altered Expression	[3]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[11]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[3]
Rhegmatogenous retinal detachment	DISLE27J	Strong	Biomarker	[12]
Spondyloarthropathy	DISBPYCZ	Strong	Altered Expression	[11]
Carcinoma	DISH9F1N	moderate	Biomarker	[10]
Clear cell renal carcinoma	DISBXRFJ	moderate	Altered Expression	[10]
Renal cell carcinoma	DISQZ2X8	moderate	Altered Expression	[10]
Hepatocellular carcinoma	DIS0J828	Disputed	Biomarker	[13]
Lung cancer	DISCM4YA	Limited	Biomarker	[14]
Lung carcinoma	DISTR26C	Limited	Biomarker	[14]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[15]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	Fructose-bisphosphate aldolase A (ALDOA) affects the binding of 4-hydroxy-2-nonenal.	[47]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Fructose-bisphosphate aldolase A (ALDOA).	[16]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Fructose-bisphosphate aldolase A (ALDOA).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Fructose-bisphosphate aldolase A (ALDOA).	[37]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Fructose-bisphosphate aldolase A (ALDOA).	[38]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Fructose-bisphosphate aldolase A (ALDOA).	[40]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[18]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[19]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[20]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[22]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[23]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[24]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[25]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Fructose-bisphosphate aldolase A (ALDOA).	[26]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[27]
Marinol	DM70IK5	Approved	Marinol increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[28]
Selenium	DM25CGV	Approved	Selenium increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[29]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[30]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[19]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[31]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[19]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[19]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[19]
Dopamine	DMPGUCF	Approved	Dopamine increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[32]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[33]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[34]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[35]
Nabiximols	DMHKJ5I	Phase 3	Nabiximols decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[36]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[41]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[24]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[42]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[43]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[44]
Okadaic acid	DM47CO1	Investigative	Okadaic acid decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[45]
PP-242	DM2348V	Investigative	PP-242 decreases the expression of Fructose-bisphosphate aldolase A (ALDOA).	[46]

References

• [1] Human aldolase A deficiency associated with a hemolytic anemia: thermolabile aldolase due to a single base mutation. Proc Natl Acad Sci U S A. 1987 Dec;84(23):8623-7. doi: 10.1073/pnas.84.23.8623.
• [2] Computational and Experimental Studies of Inhibitor Design for Aldolase A.J Phys Chem B. 2019 Jul 18;123(28):6034-6041. doi: 10.1021/acs.jpcb.9b04551. Epub 2019 Jul 3.
• [3] Proteomic profiling of osteosarcoma cells identifies ALDOA and SULT1A3 as negative survival markers of human osteosarcoma.Mol Carcinog. 2014 Feb;53(2):138-44. doi: 10.1002/mc.21957. Epub 2012 Sep 4.
• [4] Glycolytic cancer associated fibroblasts promote breast cancer tumor growth, without a measurable increase in angiogenesis: evidence for stromal-epithelial metabolic coupling.Cell Cycle. 2010 Jun 15;9(12):2412-22. doi: 10.4161/cc.9.12.11989. Epub 2010 Jun 15.
• [5] miR-122-5p Inhibits the Proliferation, Invasion and Growth of Bile Duct Carcinoma Cells by Targeting ALDOA.Cell Physiol Biochem. 2018;48(6):2596-2606. doi: 10.1159/000492702. Epub 2018 Aug 17.
• [6] Advantages and pitfalls of an extended gene panel for investigating complex neurometabolic phenotypes.Brain. 2016 Nov 1;139(11):2844-2854. doi: 10.1093/brain/aww221.
• [7] A thermolabile aldolase A mutant causes fever-induced recurrent rhabdomyolysis without hemolytic anemia.PLoS Genet. 2014 Nov 13;10(11):e1004711. doi: 10.1371/journal.pgen.1004711. eCollection 2014 Nov.
• [8] Comparative proteome analysis of human adenocarcinoma.Med Oncol. 2010 Jun;27(2):346-56. doi: 10.1007/s12032-009-9216-x. Epub 2009 Apr 21.
• [9] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [10] High expression of fructose-bisphosphate aldolaseA induces progression of renal cell carcinoma.Oncol Rep. 2018 Jun;39(6):2996-3006. doi: 10.3892/or.2018.6378. Epub 2018 Apr 18.
• [11] Chronically inflamed synovium from spondyloarthropathy and rheumatoid arthritis investigated by protein expression profiling followed by tandem mass spectrometry.Proteomics. 2005 May;5(8):2247-57. doi: 10.1002/pmic.200401109.
• [12] iTRAQ Quantitative Proteomic Analysis of Vitreous from Patients with Retinal Detachment.Int J Mol Sci. 2018 Apr 11;19(4):1157. doi: 10.3390/ijms19041157.
• [13] Fructose-Bisphosphate Aldolase A Regulates Hypoxic Adaptation in Hepatocellular Carcinoma and Involved with Tumor Malignancy.Dig Dis Sci. 2019 Nov;64(11):3215-3227. doi: 10.1007/s10620-019-05642-2. Epub 2019 Apr 30.
• [14] Feedback regulation of ALDOA activates the HIF-1/MMP9 axis to promote lung cancer progression.Cancer Lett. 2017 Sep 10;403:28-36. doi: 10.1016/j.canlet.2017.06.001. Epub 2017 Jun 10.
• [15] Long noncoding RNA DIO3OS interacts with miR-122 to promote proliferation and invasion of pancreatic cancer cells through upregulating ALDOA.Cancer Cell Int. 2019 Jul 30;19:202. doi: 10.1186/s12935-019-0922-y. eCollection 2019.
• [16] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [17] Proteomics investigations of drug-induced hepatotoxicity in HepG2 cells. Toxicol Sci. 2011 Mar;120(1):109-22.
• [18] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [19] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [20] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [21] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [22] Differential protein expression of peroxiredoxin I and II by benzo(a)pyrene and quercetin treatment in 22Rv1 and PrEC prostate cell lines. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):197-210. doi: 10.1016/j.taap.2006.12.030. Epub 2007 Jan 9.
• [23] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [24] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [25] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [26] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [27] Proteomic identification of differentially expressed proteins associated with the multiple drug resistance in methotrexate-resistant human breast cancer cells. Int J Oncol. 2014 Jul;45(1):448-58.
• [28] Genomic and proteomic analysis of the effects of cannabinoids on normal human astrocytes. Brain Res. 2008 Jan 29;1191:1-11.
• [29] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [30] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [31] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [32] Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
• [33] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [34] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [35] Curcumin inhibits hypoxia-inducible factor-1 by degrading aryl hydrocarbon receptor nuclear translocator: a mechanism of tumor growth inhibition. Mol Pharmacol. 2006 Nov;70(5):1664-71. doi: 10.1124/mol.106.025817. Epub 2006 Jul 31.
• [36] Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
• [37] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [38] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [39] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [40] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [41] Proteomics and disease network associations evaluation of environmentally relevant Bisphenol A concentrations in a human 3D neural stem cell model. Front Cell Dev Biol. 2023 Aug 16;11:1236243. doi: 10.3389/fcell.2023.1236243. eCollection 2023.
• [42] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [43] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.
• [44] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [45] Proteomic analysis reveals multiple patterns of response in cells exposed to a toxin mixture. Chem Res Toxicol. 2009 Jun;22(6):1077-85.
• [46] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
• [47] Site-specific protein adducts of 4-hydroxy-2(E)-nonenal in human THP-1 monocytic cells: protein carbonylation is diminished by ascorbic acid. Chem Res Toxicol. 2010 Jan;23(1):37-47. doi: 10.1021/tx9002462.