Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWTHD77)

DOT Name RNA-binding protein 45 (RBM45)
Synonyms Developmentally-regulated RNA-binding protein 1; RB-1; RNA-binding motif protein 45
Gene Name RBM45
Related Disease
Acute lymphocytic leukaemia ( )
Acute myelogenous leukaemia ( )
Addison disease ( )
Childhood acute lymphoblastic leukemia ( )
Dilated cardiomyopathy 1A ( )
Graft-versus-host disease ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Hepatitis B virus infection ( )
Uveitis ( )
Advanced cancer ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Arthritis ( )
Autoimmune polyendocrinopathy ( )
Chronic hepatitis B virus infection ( )
Chronic renal failure ( )
End-stage renal disease ( )
Follicular lymphoma ( )
Hashimoto thyroiditis ( )
Hepatocellular carcinoma ( )
Human papillomavirus infection ( )
Juvenile idiopathic arthritis ( )
Melanoma ( )
Pemphigus ( )
Plasma cell myeloma ( )
Primary biliary cholangitis ( )
Pulmonary tuberculosis ( )
Sjogren syndrome ( )
Systemic sclerosis ( )
Vasculitis ( )
Neuromyelitis optica ( )
Non-hodgkin lymphoma ( )
Aplastic anemia ( )
Idiopathic inflammatory myopathy ( )
Leprosy ( )
Nasopharyngeal carcinoma ( )
Nervous system inflammation ( )
Psoriasis ( )
Retinoblastoma ( )
Rheumatic fever ( )
UniProt ID
RBM45_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7CSX; 7CSZ
Pfam ID
PF00076
Sequence
MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDK
HTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEEL
TRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIEN
CDRSFRAILAEPKNKASESSEQDYYSNMRQEALGHEPRVNMFPFVGEQQSEFSSFDKNDS
RGQEAISKRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVQRDPYSNYGHGVVQYFNVASAI
YAKYKLHGFQYPPGNRIGVSFIDDGSNATDLLRKMATQMVAAQLASMVWNNPSQQQFMQF
GGSSGSQLPQIQTDVVLPSCKKKAPAETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIE
VYLVSGKNVGYAKYADRISANDAIATLHGKILNGVRLKVMLADSPREESNKRQRTY
Function RNA-binding protein with binding specificity for poly(C). May play an important role in neural development.

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute lymphocytic leukaemia DISPX75S Definitive Genetic Variation [1]
Acute myelogenous leukaemia DISCSPTN Definitive Biomarker [2]
Addison disease DIS7HNOH Definitive Genetic Variation [3]
Childhood acute lymphoblastic leukemia DISJ5D6U Definitive Genetic Variation [1]
Dilated cardiomyopathy 1A DIS0RK9Z Definitive Biomarker [4]
Graft-versus-host disease DIS0QADF Definitive Genetic Variation [5]
Hepatitis DISXXX35 Definitive Genetic Variation [6]
Hepatitis A virus infection DISUMFQV Definitive Genetic Variation [6]
Hepatitis B virus infection DISLQ2XY Definitive Biomarker [7]
Uveitis DISV0RYS Definitive Biomarker [8]
Advanced cancer DISAT1Z9 Strong Genetic Variation [9]
Alzheimer disease DISF8S70 Strong Genetic Variation [10]
Amyotrophic lateral sclerosis DISF7HVM Strong Biomarker [11]
Arthritis DIST1YEL Strong Biomarker [12]
Autoimmune polyendocrinopathy DISOLDB2 Strong Biomarker [13]
Chronic hepatitis B virus infection DISHL4NT Strong Genetic Variation [14]
Chronic renal failure DISGG7K6 Strong Genetic Variation [15]
End-stage renal disease DISXA7GG Strong Genetic Variation [15]
Follicular lymphoma DISVEUR6 Strong Genetic Variation [16]
Hashimoto thyroiditis DIS77CDF Strong Biomarker [17]
Hepatocellular carcinoma DIS0J828 Strong Genetic Variation [18]
Human papillomavirus infection DISX61LX Strong Biomarker [19]
Juvenile idiopathic arthritis DISQZGBV Strong Biomarker [20]
Melanoma DIS1RRCY Strong Genetic Variation [21]
Pemphigus DISZAZ6M Strong Biomarker [22]
Plasma cell myeloma DIS0DFZ0 Strong Genetic Variation [23]
Primary biliary cholangitis DIS43E0O Strong Genetic Variation [24]
Pulmonary tuberculosis DIS6FLUM Strong Biomarker [25]
Sjogren syndrome DISUBX7H Strong Biomarker [26]
Systemic sclerosis DISF44L6 Strong Biomarker [27]
Vasculitis DISQRKDX Strong Biomarker [28]
Neuromyelitis optica DISBFGKL moderate Genetic Variation [29]
Non-hodgkin lymphoma DISS2Y8A moderate Genetic Variation [30]
Aplastic anemia DISJRSC0 Limited Biomarker [31]
Idiopathic inflammatory myopathy DISGB1BZ Limited Biomarker [32]
Leprosy DISAA4UI Limited Genetic Variation [33]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [34]
Nervous system inflammation DISB3X5A Limited Biomarker [35]
Psoriasis DIS59VMN Limited Biomarker [36]
Retinoblastoma DISVPNPB Limited Posttranslational Modification [37]
Rheumatic fever DISLUF66 Limited Genetic Variation [38]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of RNA-binding protein 45 (RBM45). [39]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of RNA-binding protein 45 (RBM45). [40]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of RNA-binding protein 45 (RBM45). [41]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of RNA-binding protein 45 (RBM45). [42]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of RNA-binding protein 45 (RBM45). [43]
Quercetin DM3NC4M Approved Quercetin decreases the expression of RNA-binding protein 45 (RBM45). [45]
Testosterone DM7HUNW Approved Testosterone decreases the expression of RNA-binding protein 45 (RBM45). [46]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of RNA-binding protein 45 (RBM45). [47]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of RNA-binding protein 45 (RBM45). [44]
------------------------------------------------------------------------------------

References

1 Influence of Differently Licensed KIR2DL1-Positive Natural Killer Cells in Transplant Recipients with Acute Leukemia: A Japanese National Registry Study.Biol Blood Marrow Transplant. 2016 Mar;22(3):423-31. doi: 10.1016/j.bbmt.2015.09.029. Epub 2015 Oct 9.
2 Impact of HLA Allele Mismatch at HLA-A, -B, -C, and -DRB1 in Single Cord Blood Transplantation.Biol Blood Marrow Transplant. 2020 Mar;26(3):519-528. doi: 10.1016/j.bbmt.2019.11.001. Epub 2019 Nov 9.
3 DLA class II haplotypes show sex-specific associations with primary hypoadrenocorticism in Standard Poodle dogs.Immunogenetics. 2019 May;71(5-6):373-382. doi: 10.1007/s00251-019-01113-0. Epub 2019 Apr 9.
4 HLA class II polymorphisms in Tunisian patients with dilated cardiomyopathy.Tissue Antigens. 2010 Jun;75(6):679-83. doi: 10.1111/j.1399-0039.2009.01432.x. Epub 2010 Jan 28.
5 Significance of ethnicity in the risk of acute graft-versus-host disease and leukemia relapse after unrelated donor hematopoietic stem cell transplantation.Biol Blood Marrow Transplant. 2013 Aug;19(8):1197-203. doi: 10.1016/j.bbmt.2013.05.020. Epub 2013 Jun 6.
6 The association between the genetic polymorphism of HLA-DQA1, DQB1, and DRB1 and serum alanine aminotransferase levels in chronic hepatitis C in the Chinese population.J Gastroenterol Hepatol. 2008 Sep;23(9):1394-402. doi: 10.1111/j.1440-1746.2007.05215.x. Epub 2007 Nov 19.
7 Association of human leukocyte antigen polymorphisms with occult hepatitis B virus infection in a Shaanxi Han population.J Gene Med. 2017 Sep;19(9-10). doi: 10.1002/jgm.2987. Epub 2017 Oct 18.
8 HLA alleles and HLA-B27 haplotypes associated with susceptibility and severity of ankylosing spondylitis in a Portuguese population.Tissue Antigens. 2013 Dec;82(6):374-9. doi: 10.1111/tan.12238.
9 Sex-specific survival difference in association with HLA-DRB1?4 following allogeneic haematopoietic stem cell transplantation for lymphoid malignancies.Hum Immunol. 2018 Jan;79(1):13-19. doi: 10.1016/j.humimm.2017.10.010. Epub 2017 Oct 31.
10 Fine-mapping of the human leukocyte antigen locus as a risk factor for Alzheimer disease: A case-control study.PLoS Med. 2017 Mar 28;14(3):e1002272. doi: 10.1371/journal.pmed.1002272. eCollection 2017 Mar.
11 The roles of intrinsic disorder-based liquid-liquid phase transitions in the "Dr. Jekyll-Mr. Hyde" behavior of proteins involved in amyotrophic lateral sclerosis and frontotemporal lobar degeneration.Autophagy. 2017;13(12):2115-2162. doi: 10.1080/15548627.2017.1384889. Epub 2017 Dec 17.
12 Association of HLA-DRB1 shared epitope alleles and immune checkpoint inhibitor-induced inflammatory arthritis.Rheumatology (Oxford). 2019 Mar 1;58(3):476-480. doi: 10.1093/rheumatology/key358.
13 HLA class II haplotypes differentiate between the adult autoimmune polyglandular syndrome types II and III.J Clin Endocrinol Metab. 2014 Jan;99(1):E177-82. doi: 10.1210/jc.2013-2852. Epub 2013 Dec 20.
14 Association of human leukocyte antigen DQB1 and DRB1 alleles with chronic hepatitis B.World J Gastroenterol. 2014 Jul 7;20(25):8179-86. doi: 10.3748/wjg.v20.i25.8179.
15 A single center study of protective and susceptible HLA alleles and haplotypes with end-stage renal disease in China.Hum Immunol. 2019 Nov;80(11):943-947. doi: 10.1016/j.humimm.2019.09.001. Epub 2019 Sep 11.
16 The association between HLA and non-Hodgkin lymphoma subtypes, among a transplant-indicated population.Leuk Lymphoma. 2019 Dec;60(12):2899-2908. doi: 10.1080/10428194.2019.1617858. Epub 2019 Jun 19.
17 Interaction of HLA-DRB1* alleles and CTLA4 (+49 AG) gene polymorphism in Autoimmune Thyroid Disease.Gene. 2018 Feb 5;642:430-438. doi: 10.1016/j.gene.2017.11.057. Epub 2017 Nov 22.
18 Association between HLA-DQA1/DRB1 polymorphism and development of hepatocellular carcinoma during entecavir treatment.J Gastroenterol Hepatol. 2019 May;34(5):937-946. doi: 10.1111/jgh.14454. Epub 2018 Sep 26.
19 Variations in immunogenetics, human papillomavirus (HPV) infection & predisposition to cervical cancer in Indian women.Indian J Med Res. 2014 Nov;140 Suppl(Suppl 1):S36-43.
20 Juvenile idiopathic arthritis and HLA class I and class II interactions and age-at-onset effects.Arthritis Rheum. 2010 Jun;62(6):1781-91. doi: 10.1002/art.27424.
21 Genetic polymorphism of NK receptors and their ligands in melanoma patients: prevalence of inhibitory over activating signals.Cancer Immunol Immunother. 2005 Feb;54(2):172-8. doi: 10.1007/s00262-004-0575-z. Epub 2004 Jul 10.
22 Human leukocyte antigens class I and class II in patients with pemphigus in southern Turkey.Int J Dermatol. 2013 Jan;52(1):53-8. doi: 10.1111/j.1365-4632.2012.05541.x.
23 The presence of DRB1*01 allele in multiple myeloma patients is associated with an indolent disease.Tissue Antigens. 2008 Jun;71(6):548-51. doi: 10.1111/j.1399-0039.2008.01048.x. Epub 2008 Apr 7.
24 Distinctive HLA-II association with primary biliary cholangitis on the Island of Sardinia.United European Gastroenterol J. 2017 Jun;5(4):527-531. doi: 10.1177/2050640616665030. Epub 2016 Aug 9.
25 Genetic polymorphism of human leucocyte antigen and susceptibility to multidrug-resistant and rifampicin-resistant tuberculosis in Han Chinese from Hubei Province.Int J Immunogenet. 2018 Feb;45(1):8-21. doi: 10.1111/iji.12352. Epub 2017 Dec 8.
26 In primary Sjgren's syndrome, HLA class II is associated exclusively with autoantibody production and spreading of the autoimmune response.Arthritis Rheum. 2003 Aug;48(8):2240-5. doi: 10.1002/art.11103.
27 Human leukocyte antigen (HLA)-DRB1 allele polymorphisms and systemic sclerosis.Mod Rheumatol. 2019 Nov;29(6):984-991. doi: 10.1080/14397595.2018.1519148. Epub 2019 Mar 25.
28 The association of HLA-DRB1 alleles with antineutrophil cytoplasmic antibody-associated systemic vasculitis in Chinese patients.Hum Immunol. 2011 May;72(5):422-5. doi: 10.1016/j.humimm.2011.02.017. Epub 2011 Feb 25.
29 Analysis of prognostic factors associated with longitudinally extensive transverse myelitis.Mult Scler. 2013 May;19(6):742-8. doi: 10.1177/1352458512461968. Epub 2012 Oct 4.
30 The associations of HLA-A, -B, DRB1 alleles and haplotypes in Turkish lymphoma patients.Gene. 2016 Jul 25;586(2):263-7. doi: 10.1016/j.gene.2016.04.017. Epub 2016 Apr 7.
31 Associations between the HLA-A/B/DRB1 polymorphisms and aplastic anemia: evidence from 17 case-control studies.Hematology. 2018 Apr;23(3):154-162. doi: 10.1080/10245332.2017.1375064. Epub 2017 Sep 13.
32 Human leukocyte antigen in Japanese patients with idiopathic inflammatory myopathy.Mod Rheumatol. 2020 Jul;30(4):696-702. doi: 10.1080/14397595.2019.1637593. Epub 2019 Jul 18.
33 Association analysis of human leukocyte antigen class II (DRB1) alleles with leprosy in individuals from So Lus, state of Maranho, Brazil.Mem Inst Oswaldo Cruz. 2012 Dec;107 Suppl 1:150-5. doi: 10.1590/s0074-02762012000900022.
34 The HLA-DRB1 allele polymorphisms and nasopharyngeal carcinoma.Tumour Biol. 2016 Jun;37(6):7119-28. doi: 10.1007/s13277-016-5051-9. Epub 2016 Apr 8.
35 Absence of IFN- increases brain pathology in experimental autoimmune encephalomyelitis-susceptible DRB1*0301.DQ8 HLA transgenic mice through secretion of proinflammatory cytokine IL-17 and induction of pathogenic monocytes/microglia into the central nervous system.J Immunol. 2014 Nov 15;193(10):4859-70. doi: 10.4049/jimmunol.1302008. Epub 2014 Oct 22.
36 Relationship between human leukocyte antigen DRB1 and psoriasis in Iraqi patients.Saudi Med J. 2018 Sep;39(9):886-890. doi: 10.15537/smj.2018.9.23156.
37 SUV39H1/DNMT3A-dependent methylation of the RB1 promoter stimulates PIN1 expression and melanoma development.FASEB J. 2018 Oct;32(10):5647-5660. doi: 10.1096/fj.201700645RRRRR. Epub 2018 May 11.
38 HLA class II DR and DQ genotypes and haplotypes associated with rheumatic fever among a clinically homogeneous patient population of Latvian children.Arthritis Res Ther. 2007;9(3):R58. doi: 10.1186/ar2216.
39 Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
40 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
41 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
42 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
43 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
44 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
45 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
46 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
47 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.