Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZAYWL)

• DTT Name: Estrogen receptor (ESR)
• Synonyms: Nuclear receptor subfamily 3 group A member 1; NR3A1; Estradiol receptor; ESR; ER-alpha; ER
• Gene Name: ESR1
• DTT Type: Successful target; [1]
• BioChemical Class: Nuclear hormone receptor
• UniProt ID: ESR1_HUMAN
• TTD ID: T89534
• Sequence:
  MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
  EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
  LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
  ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
  RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
  SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
  AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
  MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
  KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
  LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
• Function: Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Isoform 3 is involved in activation of NOS3 and endothelial nitric oxide production. Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Isoform 3 can bind to ERE and inhibit isoform 1.
• KEGG Pathway:
  Estrogen signaling pathway (hsa04915)
  Prolactin signaling pathway (hsa04917)
  Thyroid hormone signaling pathway (hsa04919)
  Endocrine and other factor-regulated calcium reabsorption (hsa04961)
  Proteoglycans in cancer (hsa05205)
• Reactome Pathway:
  Nuclear Receptor transcription pathway (R-HSA-383280)
  Nuclear signaling by ERBB4 (R-HSA-1251985)

Molecular Interaction Atlas (MIA) of This DTT

36 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ARZOXIFENE	DMOKCVI	Breast cancer	2C60-2C65	Approved	[2]
Bazedoxifene	DMY85QW	Hot flushes	GA30	Approved	[3]
Cenestin	DMXQS7K	Menopause symptom	GA30.0	Approved	[4]
Clomifene	DMKI7RB	Female infertility	GA31.Z	Approved	[5]
Clomiphene Citrate	DMS51VC	Female infertility	GA31.Z	Approved	[6]
Conjugated estrogens a	DMTPIZC	Hormone replacement therapy	8E01	Approved	[7]
Conjugated estrogens b	DMU7SF8	Hormone replacement therapy	8E01	Approved	[8]
Cyclofenil	DMT5RMB	Infertility	GB04	Approved	[9]
Danazol	DML8KTN	Menorrhagia	GA20.50	Approved	[10]
Dienestrol	DMBSXI0	Atrophic vaginitis	GA30.2	Approved	[11]
Diethylstilbestrol	DMN3UXQ	Gonorrheal vaginitis	GA02	Approved	[12]
Elacestrant	DM8RLJ5	Breast cancer	2C60-2C65	Approved	[13]
Esterified estrogens	DM9KZDO	Breast cancer	2C60-2C65	Approved	[14]
Estradiol	DMUNTE3	Acne vulgaris	ED80	Approved	[15]
Estradiol Acetate	DM07U2A	Hormone replacement therapy	8E01	Approved	[6]
Estradiol Cypionate	DM27Z5T	Hormone replacement therapy	8E01	Approved	[6]
Estradiol Valerate	DM8MC6O	Hormone replacement therapy	8E01	Approved	[6]
Estriol	DMOEM2I	Hormone deficiency	5A61.1	Approved	[15]
Estrogen	DMGY0UT	Menopause symptom	GA30.0	Approved	[16]
Estrone	DM5T6US	Acne vulgaris	ED80	Approved	[15]
Estropipate	DMRMDWA	Hypogonadism	5A61.0	Approved	[17]
Ethinyl Estradiol	DMODJ40	Acne vulgaris	ED80	Approved	[18]
Fosfestrol	DMD072M	Solid tumour/cancer	2A00-2F9Z	Approved	[19]
Fulvestrant	DM0YZC6	Breast cancer	2C60-2C65	Approved	[1]
Gestrinone	DMP0OVQ	Breast cancer	2C60-2C65	Approved	[7]
Lasofoxifene	DMHA18P	Osteoporosis	FB83.0	Approved	[20]
Levormeloxifene	DM2XVNI	Breast cancer	2C60-2C65	Approved	[21]
Mestranol	DMG3F94	Contraception	QA21	Approved	[22]
Mitotane	DMU1GX0	Adrenocortical carcinoma	2D11.Z	Approved	[23]
Nomegestrol acetate	DMRJ7D1	Breast cancer	2C60-2C65	Approved	[24]
Ospemifene	DMC4GEI	Dyspareunia	GA12	Approved	[25]
Promestriene	DMU92F8	Acne vulgaris	ED80	Approved	[26]
Quinestrol	DMJ6H1Z	Breast cancer	2C60-2C65	Approved	[27]
Raloxifene	DMDKF3M	Osteoporosis	FB83.0	Approved	[28]
Tamoxifen	DMLB0EZ	Breast cancer	2C60-2C65	Approved	[29]
Toremifene	DMQYUWG	Breast cancer	2C60-2C65	Approved	[30]

28 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acolbifene	DM3UQ9K	Breast cancer	2C60-2C65	Phase 3	[31]
Giredestrant	DMBSFFK	Breast cancer	2C60-2C65	Phase 3	[32]
Imlunestrant	DMYBWL9	Breast cancer	2C60-2C65	Phase 3	[33]
NE3107	DMEZNJI	Alzheimer disease	8A20	Phase 3	[34]
NPC-01	DMMC3Y8	Dysmenorrhea	GA34.3	Phase 3	[35]
Synthetic conjugated estrogen	DMRUEKC	Vaginal disease	GA1Y	Phase 3	[36]
TZTX-001	DM71ZL6	Endometriosis	GA10	Phase 3	[37]
Afimoxifene	DMFORDT	Breast cancer	2C60-2C65	Phase 2	[28]
ARN-810	DML3PJF	Breast cancer	2C60-2C65	Phase 2	[38]
AZD9833	DMQOTHP	ER-positive breast cancer	2C60-2C65	Phase 2	[39]
Endoxifen	DMTX8IZ	Breast cancer	2C60-2C65	Phase 2	[28]
Estetrol	DMTB63Q	Autoimmune diabetes	5A10	Phase 2	[40]
GTx-758	DMDWYZS	Prostate cancer	2C82.0	Phase 2	[41]
ICARITIN	DMGHQ37	Breast cancer	2C60-2C65	Phase 2	[42]
SR 16234	DMRFO34	Breast cancer	2C60-2C65	Phase 2	[43]
H3B-6545	DMIFCY2	Breast cancer	2C60-2C65	Phase 1/2	[44]
OP-1250	DMIU26T	Breast cancer	2C60-2C65	Phase 1/2	[45]
ZN-c5	DMVG4OC	Breast cancer	2C60-2C65	Phase 1/2	[46]
AC0682	DM49FVF	Breast cancer	2C60-2C65	Phase 1	[47]
ATD transdermal gel	DMIMH8L	Contraception	QA21	Phase 1	[28]
AZD9496	DMPMDTH	Breast cancer	2C60-2C65	Phase 1	[44]
CC-8490	DMXUT3Z	Brain cancer	2A00	Phase 1	[48]
CHF-4227	DMTE18G	Osteoporosis	FB83.0	Phase 1	[49]
D-0502	DMGA1DS	Breast cancer	2C60-2C65	Phase 1	[50]
G1T-48	DMRGP72	Breast cancer	2C60-2C65	Phase 1	[51]
LY3484356	DMY8W3S	Breast cancer	2C60-2C65	Phase 1	[52]
SCO-120	DMB1MZS	Breast cancer	2C60-2C65	Phase 1	[53]
TTC-352	DM7CHZ2	Breast cancer	2C60-2C65	Phase 1	[44]

21 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BITHIONOL	DMPJKRL	Trematode infection	1F8Y	Withdrawn from market	[54]
Chlorotrianisene	DMSV2WZ	Menopause symptom	GA30.0	Withdrawn from market	[55]
HEXESTROL	DM9AGWQ	Irregularities	N.A.	Withdrawn from market	[56]
EM-800	DM5JUW0	Estrogen deficiency	FB83.0Y	Discontinued in Phase 3	[57]
Idoxifene	DMRXUY7	Breast cancer	2C60-2C65	Discontinued in Phase 3	[58]
IoGen	DMVL8PB	Pain	MG30-MG3Z	Discontinued in Phase 3	[28]
Miproxifene	DMMZO8X	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 3	[59]
Droloxifene	DM9JPUD	Breast cancer	2C60-2C65	Discontinued in Phase 2	[60]
ERA-923	DM6NTAS	Breast cancer	2C60-2C65	Discontinued in Phase 2	[61]
NP-50301	DMPMR2I	Eye disorder	9A01-9A0Z	Discontinued in Phase 2	[62]
Panomifene	DME4RSI	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[63]
SERM-3339	DMSLP2O	Osteoporosis	FB83.0	Discontinued in Phase 2	[64]
SR-90067	DMROKDM	Hormone deficiency	5A61.1	Discontinued in Phase 2	[65]
HE2100	DMCP2KH	Thrombocytopenia	3B64	Discontinued in Phase 1	[66]
HRT	DMQYWAH	Estrogen deficiency	FB83.0Y	Discontinued in Phase 1	[67]
MX-4509	DMC4RK7	Neurological disorder	6B60	Discontinued in Phase 1	[68]
ICI-164384	DMYN3WG	Breast cancer	2C60-2C65	Terminated	[71]
LY-117018	DMUHG0F	N. A.	N. A.	Terminated	[72]
Tamoxifen methyl iodide	DM54V0X	N. A.	N. A.	Terminated	[73]
Zindoxifene	DM81DJV	Breast cancer	2C60-2C65	Terminated	[74]
ZK-119010	DMKFYDE	Carcinoma	2A00-2F9Z	Terminated	[75]

6 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BN-AA-003-NY	DMCPQJ9	Estrogen deficiency	FB83.0Y	Preclinical	[69]
BN-AO-014	DMVMY4X	Atrophy	9A2Y-9C40	Preclinical	[69]
BN-CB-045	DMBPTDC	Female sexual arousal dysfunction	HA01.1	Preclinical	[69]
BN-DF-037	DMFNLE6	Osteoporosis	FB83.0	Preclinical	[69]
BN-GU-005-DHP	DM0PJU9	Arthralgia	ME82	Preclinical	[69]
BN-OD-026	DM8WDAL	Solid tumour/cancer	2A00-2F9Z	Preclinical	[70]

195 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,2-Bis-(4-hydroxy-phenyl)-3H-inden-5-ol	DM9RF1T	Discovery agent	N.A.	Investigative	[76]
1,8-Dichloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DMKJBRZ	Discovery agent	N.A.	Investigative	[77]
1-Bromo-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DM2T4NL	Discovery agent	N.A.	Investigative	[77]
1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL	DM0MGFQ	Discovery agent	N.A.	Investigative	[77]
1-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DM8BC1M	Discovery agent	N.A.	Investigative	[77]
17-METHYL-17-ALPHA-DIHYDROEQUILENIN	DMKUGH1	Discovery agent	N.A.	Investigative	[78]
2,3-diphenyl-1H-indole	DMC3UYH	Discovery agent	N.A.	Investigative	[79]
2,4-Dibenzylamino-6-isopentylpyrimidine	DMQ385U	Discovery agent	N.A.	Investigative	[80]
2,4-diisobutylamino-6-isopentylpyrimidine	DM0URFY	Discovery agent	N.A.	Investigative	[80]
2-(2-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol	DMWDV71	Discovery agent	N.A.	Investigative	[81]
2-(3-Butoxy-4-hydroxy-phenyl)-benzooxazol-6-ol	DMJM5VW	Discovery agent	N.A.	Investigative	[81]
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol	DMBONUV	Discovery agent	N.A.	Investigative	[81]
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-6-ol	DM3B6IN	Discovery agent	N.A.	Investigative	[81]
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-5-ol	DMNTHK5	Discovery agent	N.A.	Investigative	[81]
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-6-ol	DM50FW1	Discovery agent	N.A.	Investigative	[81]
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol	DMZCE18	Discovery agent	N.A.	Investigative	[82]
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-6-ol	DMIGXRJ	Discovery agent	N.A.	Investigative	[82]
2-(4-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol	DMUGHF6	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-4-methoxy-quinolin-6-ol	DM4N0LB	Discovery agent	N.A.	Investigative	[83]
2-(4-Hydroxy-phenyl)-4-vinyl-quinolin-6-ol	DM81G2U	Discovery agent	N.A.	Investigative	[83]
2-(4-Hydroxy-phenyl)-7-isopropyl-benzooxazol-5-ol	DMFWOMY	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-7-methoxy-benzofuran-5-ol	DMY0I8P	Discovery agent	N.A.	Investigative	[84]
2-(4-Hydroxy-phenyl)-7-methoxy-benzooxazol-5-ol	DMCNITS	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-7-methyl-benzofuran-5-ol	DMQ2KPI	Discovery agent	N.A.	Investigative	[84]
2-(4-Hydroxy-phenyl)-7-phenyl-benzooxazol-5-ol	DMUB7KH	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-7-propenyl-benzooxazol-5-ol	DMND63Z	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-7-propyl-benzooxazol-5-ol	DMONT2D	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-7-vinyl-benzooxazol-5-ol	DM2F6U3	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-benzooxazol-5-ol	DMMUNA7	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-benzooxazol-6-ol	DM31MY0	Discovery agent	N.A.	Investigative	[81]
2-(4-Hydroxy-phenyl)-quinolin-6-ol	DMCWFUZ	Discovery agent	N.A.	Investigative	[83]
2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL	DMN6S3F	Discovery agent	N.A.	Investigative	[81]
2-(4-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol	DMW6L38	Discovery agent	N.A.	Investigative	[82]
2-(5-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol	DMB3JG0	Discovery agent	N.A.	Investigative	[81]
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-5-ol	DMXAVHT	Discovery agent	N.A.	Investigative	[81]
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol	DM3GQN2	Discovery agent	N.A.	Investigative	[81]
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-5-ol	DM715EC	Discovery agent	N.A.	Investigative	[81]
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-6-ol	DMANHOT	Discovery agent	N.A.	Investigative	[81]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Discovery agent	N.A.	Investigative	[78]
2-Naphthalen-1-yl-benzooxazol-6-ol	DMBI6U9	Discovery agent	N.A.	Investigative	[81]
2-phenyl-1,2'-spirobi[1H-indene]-5'-ol	DMP8G3C	Discovery agent	N.A.	Investigative	[82]
3'-Methoxy-4'Hydroxyclomiphene	DMG1T6H	Discovery agent	N.A.	Investigative	[85]
3,8-dihydroxy-4-methyl-6H-benzo[c]chromen-6-one	DMIFJRS	Discovery agent	N.A.	Investigative	[86]
3,8-dihydroxy-7-methyl-6H-benzo[c]chromen-6-one	DMW0B4H	Discovery agent	N.A.	Investigative	[86]
3-(2-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol	DMD24EW	Discovery agent	N.A.	Investigative	[81]
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-5-ol	DMXZ9T6	Discovery agent	N.A.	Investigative	[81]
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol	DMYLDFG	Discovery agent	N.A.	Investigative	[81]
3-(4-Hydroxyphenyl)-7-isobutoxychromen-4-one	DMS5N6Y	Discovery agent	N.A.	Investigative	[87]
3-(4-Hydroxyphenyl)-7-isopropoxychromen-4-one	DMH75AO	Discovery agent	N.A.	Investigative	[87]
3-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol	DMPRBLH	Discovery agent	N.A.	Investigative	[81]
3-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol	DM5H9QT	Discovery agent	N.A.	Investigative	[81]
3-CHLORO-2-(4-HYDROXYPHENYL)-2H-INDAZOL-5-OL	DM3R8OM	Discovery agent	N.A.	Investigative	[78]
3-chloro-4-(4-hydroxyphenyl)salicylaldoxime	DMER4U1	Discovery agent	N.A.	Investigative	[88]
3-ETHYL-2-(4-HYDROXYPHENYL)-2H-INDAZOL-5-OL	DMEWAVM	Discovery agent	N.A.	Investigative	[78]
3-hydroxy-8,10-dimethyl-6H-benzo[c]chromen-6-one	DM3H56L	Discovery agent	N.A.	Investigative	[86]
3-[1-ethyl-2-(3-hydroxyphenyl)butyl]phenol	DMPTI1Z	Discovery agent	N.A.	Investigative	[89]
4',5,7-trihydroxy-6,8-dimethylisoflavone	DM1RM3H	Discovery agent	N.A.	Investigative	[90]
4,10-dimethyl-6H-benzo[c]chromene-3,8-diol	DMB5RJK	Discovery agent	N.A.	Investigative	[86]
4,6,10-trimethyl-6H-benzo[c]chromene-3,8-diol	DM6N98E	Discovery agent	N.A.	Investigative	[86]
4,6,6,7-tetramethyl-6H-benzo[c]chromene-3,8-diol	DM14VI3	Discovery agent	N.A.	Investigative	[86]
4,6,7,10-tetramethyl-6H-benzo[c]chromene-3,8-diol	DMYN25U	Discovery agent	N.A.	Investigative	[86]
4,6,7-trimethyl-6H-benzo[c]chromene-3,8-diol	DMFECXI	Discovery agent	N.A.	Investigative	[86]
4,7-dimethyl-6H-benzo[c]chromene-3,8-diol	DM67Z81	Discovery agent	N.A.	Investigative	[86]
4-(1,2-Diphenyl-but-1-enyl)-phenol	DMJDW50	Discovery agent	N.A.	Investigative	[91]
4-(1-benzyl-7-chloro-1H-indazol-3-yl)phenol	DMNV9H5	Discovery agent	N.A.	Investigative	[92]
4-(1-butyl-7-chloro-1H-indazol-3-yl)phenol	DMS1OYA	Discovery agent	N.A.	Investigative	[92]
4-(1-cyclopentyl-7-fluoro-1H-indazol-3-yl)phenol	DM3NEYB	Discovery agent	N.A.	Investigative	[92]
4-(2-phenyl-1H-benzo[d]imidazol-1-yl)phenol	DMFQZOI	Discovery agent	N.A.	Investigative	[79]
4-(2-phenyl-1H-indol-3-yl)phenol	DMCPSE9	Discovery agent	N.A.	Investigative	[79]
4-(3-(4-hydroxyphenyl)-1H-indol-2-yl)phenol	DMR3T2D	Discovery agent	N.A.	Investigative	[79]
4-(3-phenyl-1H-indol-2-yl)phenol	DMEJF6V	Discovery agent	N.A.	Investigative	[79]
4-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol	DM1EANV	Discovery agent	N.A.	Investigative	[81]
4-(6-HYDROXY-1H-INDAZOL-3-YL)BENZENE-1,3-DIOL	DMHGRPB	Discovery agent	N.A.	Investigative	[78]
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol	DM38YZ4	Discovery agent	N.A.	Investigative	[81]
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol	DM07NT9	Discovery agent	N.A.	Investigative	[81]
4-(7-chloro-1-cyclohexyl-1H-indazol-3-yl)phenol	DMUXZOM	Discovery agent	N.A.	Investigative	[92]
4-(7-chloro-1-cyclopentyl-1H-indazol-3-yl)phenol	DM0X5SY	Discovery agent	N.A.	Investigative	[92]
4-(7-chloro-1-propyl-1H-indazol-3-yl)phenol	DMEYUH0	Discovery agent	N.A.	Investigative	[92]
4-(7-methyl-1-propyl-1H-indazol-3-yl)phenol	DMX2K8R	Discovery agent	N.A.	Investigative	[92]
4-Benzo[d]isoxazol-3-yl-benzene-1,3-diol	DM1UG2A	Discovery agent	N.A.	Investigative	[81]
4-benzyl-2,6-diisobutylamino-pyrimidine	DM2Q0VB	Discovery agent	N.A.	Investigative	[80]
4-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMPSRAC	Discovery agent	N.A.	Investigative	[83]
4-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMKJ18X	Discovery agent	N.A.	Investigative	[83]
4-Ethyl-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMTIY89	Discovery agent	N.A.	Investigative	[83]
4-Ethynyl-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMXLZAT	Discovery agent	N.A.	Investigative	[83]
4-hydroxy-N,N-diphenylbenzenesulfonamide	DMXPQ5H	Discovery agent	N.A.	Investigative	[93]
4-hydroxy-N-isopropyl-N-phenylbenzenesulfonamide	DMVAP9U	Discovery agent	N.A.	Investigative	[93]
4-hydroxy-N-neopentyl-N-phenylbenzenesulfonamide	DM8XOJC	Discovery agent	N.A.	Investigative	[93]
4-hydroxy-N-phenyl-N-propylbenzenesulfonamide	DM5TU98	Discovery agent	N.A.	Investigative	[93]
4-Naphthalen-2-yl-phenol	DMKPNSH	Discovery agent	N.A.	Investigative	[77]
4-[1,2-bis(4-hydroxyphenyl)but-1-enyl]phenol	DMW1IXY	Discovery agent	N.A.	Investigative	[94]
4-[1,2-bis(4-hydroxyphenyl)hex-1-enyl]phenol	DMTL6ES	Discovery agent	N.A.	Investigative	[94]
4-[1,2-bis(4-hydroxyphenyl)pent-1-enyl]phenol	DMTHG0Y	Discovery agent	N.A.	Investigative	[94]
4-[1,2-bis(4-hydroxyphenyl)vinyl]phenol	DMR7GP6	Discovery agent	N.A.	Investigative	[94]
4-[1-(4-hydroxyphenyl)-2-phenylbut-1-enyl]phenol	DMTMLXU	Discovery agent	N.A.	Investigative	[91]
4-[1-(4-hydroxyphenyl)-2-phenylhex-1-enyl]phenol	DM30421	Discovery agent	N.A.	Investigative	[91]
4-[1-(4-hydroxyphenyl)-2-phenylpent-1-enyl]phenol	DMWHKLA	Discovery agent	N.A.	Investigative	[91]
4-[1-(4-hydroxyphenyl)-2-phenylprop-1-enyl]phenol	DMH1I32	Discovery agent	N.A.	Investigative	[91]
4-[1-(4-hydroxyphenyl)-2-phenylvinyl]phenol	DM4BFPE	Discovery agent	N.A.	Investigative	[91]
4-[2,2-bis(4-hydroxyphenyl)-1-methylvinyl]phenol	DMS0HV6	Discovery agent	N.A.	Investigative	[94]
5-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol	DM2YL0T	Discovery agent	N.A.	Investigative	[83]
5-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-6-ol	DMCFIZN	Discovery agent	N.A.	Investigative	[81]
5-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMXNPSB	Discovery agent	N.A.	Investigative	[83]
5-hydroxy-2-phenylisoindoline-1,3-dione	DMLZKNF	Discovery agent	N.A.	Investigative	[95]
6-(2,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMRU963	Discovery agent	N.A.	Investigative	[77]
6-(2,6-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMFALTY	Discovery agent	N.A.	Investigative	[77]
6-(2-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol	DMTPAMS	Discovery agent	N.A.	Investigative	[77]
6-(2-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DM6Q3M7	Discovery agent	N.A.	Investigative	[77]
6-(3,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMKJOL6	Discovery agent	N.A.	Investigative	[77]
6-(3-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol	DM4YP3Q	Discovery agent	N.A.	Investigative	[77]
6-(3-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMAJEDG	Discovery agent	N.A.	Investigative	[77]
6-(3-Hydroxy-phenyl)-naphthalen-1-ol	DMMHRVO	Discovery agent	N.A.	Investigative	[77]
6-(3-Hydroxy-phenyl)-naphthalen-2-ol	DMH8WA2	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-2-methoxy-phenyl)-naphthalen-2-ol	DMYM3EW	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-2-methyl-phenyl)-naphthalen-2-ol	DMYEIRH	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-phenyl)-1-methoxy-naphthalen-2-ol	DMBG5Y8	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-phenyl)-1-methyl-naphthalen-2-ol	DMGLT0N	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-phenyl)-1-nitro-naphthalen-2-ol	DMGC84U	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-phenyl)-1-phenyl-naphthalen-2-ol	DMI6UVN	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-phenyl)-naphthalen-1-ol	DM2V9XI	Discovery agent	N.A.	Investigative	[77]
6-(4-Hydroxy-phenyl)-naphthalen-2-ol	DM3L2OI	Discovery agent	N.A.	Investigative	[83]
6-butyl-2,4-dipropylaminopyrimidine	DM46GLQ	Discovery agent	N.A.	Investigative	[80]
6-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMLMOC0	Discovery agent	N.A.	Investigative	[81]
6-ethyl-2,4-diisobutylaminopyrimidine	DMBMRUI	Discovery agent	N.A.	Investigative	[80]
6-ethyl-4,7-dimethyl-6H-benzo[c]chromene-3,8-diol	DMOGETD	Discovery agent	N.A.	Investigative	[86]
6-Phenyl-naphthalen-2-ol	DMEYOF7	Discovery agent	N.A.	Investigative	[77]
7-(3-Hydroxy-phenyl)-naphthalen-2-ol	DM2I91C	Discovery agent	N.A.	Investigative	[77]
7-(4-Hydroxy-phenyl)-naphthalen-2-ol	DMM9IXB	Discovery agent	N.A.	Investigative	[77]
7-Allyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMSRQ1L	Discovery agent	N.A.	Investigative	[81]
7-Bromo-2-(4-hydroxy-phenyl)-benzofuran-5-ol	DMA8DXG	Discovery agent	N.A.	Investigative	[84]
7-Butyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMQ8BIX	Discovery agent	N.A.	Investigative	[81]
7-Chloro-2-(4-hydroxy-phenyl)-benzofuran-5-ol	DM38HKE	Discovery agent	N.A.	Investigative	[84]
7-Cyclopentyloxy-3-(4-hydroxyphenyl)chromen-4-one	DM2MIJY	Discovery agent	N.A.	Investigative	[87]
7-Ethyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMUMN4B	Discovery agent	N.A.	Investigative	[81]
7-Ethynyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DM92EG5	Discovery agent	N.A.	Investigative	[81]
7-Phenyl-naphthalen-2-ol	DM1WJFR	Discovery agent	N.A.	Investigative	[77]
8-(2,2-dimethylpropyl)naringenin	DMV5FZO	Discovery agent	N.A.	Investigative	[96]
8-(2-methylpropyl)naringenin	DMQUZSJ	Discovery agent	N.A.	Investigative	[96]
8-(3-methylbutyl)naringenin	DM2VAJE	Discovery agent	N.A.	Investigative	[96]
8-benzylnaringenin	DMKHF87	Discovery agent	N.A.	Investigative	[96]
8-Chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DMB76ZN	Discovery agent	N.A.	Investigative	[77]
8-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DMGJ3L6	Discovery agent	N.A.	Investigative	[77]
8-methylnaringenin	DMK63P2	Discovery agent	N.A.	Investigative	[96]
8-n-heptylnaringenin	DMWMVI3	Discovery agent	N.A.	Investigative	[96]
8-n-nonylnaringenin	DMC2JLQ	Discovery agent	N.A.	Investigative	[96]
8-n-pentylnaringenin	DMRDOP0	Discovery agent	N.A.	Investigative	[96]
8-n-propylnaringenin	DMDOW5S	Discovery agent	N.A.	Investigative	[96]
8-n-undecylnaringenin	DMXURM8	Discovery agent	N.A.	Investigative	[96]
BROUSSONIN A	DMXFN6H	Discovery agent	N.A.	Investigative	[97]
Carboron Cluster with phenol	DMCNV68	Discovery agent	N.A.	Investigative	[98]
COUMESTROL	DM40TBU	Discovery agent	N.A.	Investigative	[99]
CP-394531	DMDPH3W	Discovery agent	N.A.	Investigative	[100]
CP-409069	DM1U6P7	Discovery agent	N.A.	Investigative	[100]
daidzein	DMRFTJX	Discovery agent	N.A.	Investigative	[90]
DIHYDRORALOXIFENE	DM70OIC	Discovery agent	N.A.	Investigative	[101]
Doxorubicin-Formaldehyde Conjugate	DMJF6AQ	Discovery agent	N.A.	Investigative	[102]
EFFUSOL	DMXZRND	Discovery agent	N.A.	Investigative	[86]
Estriol E3	DMNXO9C	Multiple sclerosis	8A40	Investigative	[103]
Geldanamycin-estradiol hybrid	DMUSJ96	Discovery agent	N.A.	Investigative	[104]
GSK-5182	DMNGEAY	Discovery agent	N.A.	Investigative	[105]
GW7604	DMCA4RM	Discovery agent	N.A.	Investigative	[106]
JNJ-17148066	DMJ1DE9	Discovery agent	N.A.	Investigative	[107]
JNJ-19398990	DM94IJC	Discovery agent	N.A.	Investigative	[107]
JNJ-26529126	DMK6TVN	Discovery agent	N.A.	Investigative	[107]
JNJ-26529152	DMBZ7MA	Discovery agent	N.A.	Investigative	[107]
LTERHKILHRLLQEGSPSD	DMDU6F4	Discovery agent	N.A.	Investigative	[108]
methyl-piperidino-pyrazole	DMKTOPJ	Discovery agent	N.A.	Investigative	[109]
MPrP	DMWUK9G	Discovery agent	N.A.	Investigative	[110]
N,N,N-Triisobutyl-pyrimidine-2,4,6-triamine	DMLU27Y	Discovery agent	N.A.	Investigative	[80]
N-allyl-4-hydroxy-N-phenylbenzenesulfonamide	DMZQUMB	Discovery agent	N.A.	Investigative	[93]
N-benzyl-4-hydroxy-N-phenylbenzenesulfonamide	DM5TPEJ	Discovery agent	N.A.	Investigative	[93]
N-butyl-4-hydroxy-N-phenylbenzenesulfonamide	DMH5GW6	Discovery agent	N.A.	Investigative	[93]
N-cyclohexyl-4-hydroxy-N-phenylbenzenesulfonamide	DMCDBM5	Discovery agent	N.A.	Investigative	[93]
N-ethyl-4-hydroxy-N-phenylbenzenesulfonamide	DMHY35A	Discovery agent	N.A.	Investigative	[93]
Nafoxidine	DM0FROP	Discovery agent	N.A.	Investigative	[111]
Org-37663	DM3EZDG	Discovery agent	N.A.	Investigative	[112]
propylpyrazoletriol	DMTCP8K	Discovery agent	N.A.	Investigative	[113]
R,R-THC	DM4URMA	Discovery agent	N.A.	Investigative	[114]
RG6046	DMGYWIK	Breast cancer	2C60-2C65	Investigative	[115]
SERMs	DM4ZYKV	Solid tumour/cancer	2A00-2F9Z	Investigative	[28]
SNG-163	DMOLQNK	Solid tumour/cancer	2A00-2F9Z	Investigative	[28]
SNG-8006	DMCT02Q	Osteoporosis	FB83.0	Investigative	[28]
SNG-8023	DM6O9DQ	Breast cancer	2C60-2C65	Investigative	[28]
SNG-8033	DM0W54R	leukaemia	2A60-2B33	Investigative	[28]
SOPHORAFLAVANONE B	DMUVKX5	Discovery agent	N.A.	Investigative	[96]
STX	DM7LZJ3	Estrogen deficiency	FB83.0Y	Investigative	[28]
Tamoxifen butyl bromide	DMBKL5O	Discovery agent	N.A.	Investigative	[73]
Tamoxifen ethyl bromide	DM76BXY	Discovery agent	N.A.	Investigative	[73]
Tamoxifen isopropyl bromide	DMBKWUZ	Discovery agent	N.A.	Investigative	[73]
Trans-hydroxytamoxifen	DMXS8LN	Discovery agent	N.A.	Investigative	[109]
TSERaM	DM6JF7T	Menopause symptom	GA30.0	Investigative	[28]
WAY-169916	DM94KWA	Discovery agent	N.A.	Investigative	[92]
WAY200070	DMBHXTL	Discovery agent	N.A.	Investigative	[81]
ZK-164015	DMROWV8	Discovery agent	N.A.	Investigative	[116]
[1,1':2',1'']Terphenyl-4'-carbaldehyde oxime	DMFXA8P	Discovery agent	N.A.	Investigative	[117]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Neuroectodermal tumour	2C82	Nervous tissue	2.05E-08	-0.08	-0.31
Prostate cancer	2C82	Prostate	9.80E-01	-0.11	-0.2
Breast cancer	2C82	Breast tissue	5.93E-18	0.18	0.37
Osteoporosis	FA20	Bone marrow	2.98E-01	-0.07	-0.28
Acute myelocytic leukaemia	2C82	Bone marrow	2.62E-01	-7.10E-04	-4.57E-03

References

• [1] Beta3-tubulin is induced by estradiol in human breast carcinoma cells through an estrogen-receptor dependent pathway. Cell Motil Cytoskeleton. 2009 Jul;66(7):378-88.
• [2] Benzothiophene selective estrogen receptor modulators with modulated oxidative activity and receptor affinity. J Med Chem. 2007 May 31;50(11):2682-92.
• [3] Bazedoxifene, a selective estrogen receptor modulator: effects on the endometrium, ovaries, and breast from a randomized controlled trial in osteoporotic postmenopausal women. Menopause. 2009 Nov-Dec;16(6):1109-15.
• [4] Estrogen replacement therapy and cardioprotection: mechanisms and controversies. Braz J Med Biol Res. 2002 Mar;35(3):271-6.
• [5] The future of the new selective estrogen receptor modulators. Menopause Int. 2007 Mar;13(1):27-34.
• [6] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [7] Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
• [8] Effect of MK-486 alone on Parkinsonism; studies on the clinical symptoms and catecholamine concentrations in the blood, urine and cerebrospinal fluid. No To Shinkei. 1977 Feb;29(2):205-13.
• [9] Fluorine-substituted cyclofenil derivatives as estrogen receptor ligands: synthesis and structure-affinity relationship study of potential positron emission tomography agents for imaging estrogen receptors in breast cancer. J Med Chem. 2006 Apr 20;49(8):2496-511.
• [10] Danazol suppression of luteinizing hormone in the rat: evidence for mediation by both androgen and estrogen receptors. Proc Soc Exp Biol Med. 1990 May;194(1):54-7.
• [11] Potential use of an estrogen-glucocorticoid receptor chimera as a drug screen for tissue selective estrogenic activity. Bone. 2009 Jan;44(1):102-12.
• [12] Effects of diethylstilbestrol on programmed oocyte death and induction of polyovular follicles in neonatal mouse ovaries. Biol Reprod. 2009 Nov;81(5):1002-9.
• [13] RAD1901: a novel, orally bioavailable selective estrogen receptor degrader that demonstrates antitumor activity in breast cancer xenograft models. Anticancer Drugs. 2015 Oct;26(9):948-56.
• [14] Safety and efficacy of low-dose esterified estrogens and methyltestosterone, alone or combined, for the treatment of hot flashes in menopausal women: a randomized, double-blind, placebo-controlled study. Fertil Steril. 2011 Jan;95(1):366-8.
• [15] Reprint of Are all estrogens the same Maturitas. 2008 Sep-Oct;61(1-2):195-201.
• [16] Estrogen-receptor polymorphisms and effects of estrogen replacement on high-density lipoprotein cholesterol in women with coronary disease. N Engl J Med. 2002 Mar 28;346(13):967-74.
• [17] US patent application no. 5,004,651, Stabilizing system for solid dosage forms.
• [18] 17alpha-Ethinylestradiol hinders nucleotide excision repair in zebrafish liver cells. Aquat Toxicol. 2009 Dec 13;95(4):273-8.
• [19] Impact of natural products on developing new anti-cancer agents. Chem Rev. 2009 Jul;109(7):3012-43.
• [20] Pfizer. Product Development Pipeline. March 31 2009.
• [21] Centchroman, a selective estrogen receptor modulator, as a contraceptive and for the management of hormone-related clinical disorders. Med Res Rev. 2001 Jul;21(4):302-47.
• [22] Short-term effects of environmentally relevant concentrations of EDC mixtures on Mytilus galloprovincialis digestive gland. Aquat Toxicol. 2008 May 30;87(4):272-9.
• [23] Mitotane for adrenocortical carcinoma treatment. Curr Opin Investig Drugs. 2005 Apr;6(4):386-94.
• [24] Regulation of rat uterine steroid receptors by nomegestrol acetate, a new 19-nor-progesterone derivative. J Pharmacol Exp Ther. 1989 Feb;248(2):758-61.
• [25] Clinical pipeline report, company report or official report of Shionogi (2011).
• [26] Promestriene, a specific topic estrogen. Review of 40 years of vaginal atrophy treatment: is it safe even in cancer patients. Anticancer Drugs. 2013 Nov;24(10):989-98.
• [27] The antioxidant effect of estrogen and Selective Estrogen Receptor Modulators in the inhibition of osteocyte apoptosis in vitro. Bone. 2007 Mar;40(3):674-84.
• [28] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 620).
• [29] Modulators of vascular sex hormone receptors and their effects in estrogen-deficiency states associated with menopause. Recent Pat Cardiovasc Drug Discov. 2008 Nov;3(3):165-86.
• [30] Effect of selective estrogen receptor modulators on cell proliferation and estrogen receptor activities in normal human prostate stromal and epithe... Prostate Cancer Prostatic Dis. 2009;12(4):375-81.
• [31] Bioactivation of the selective estrogen receptor modulator acolbifene to quinone methides. Chem Res Toxicol. 2005 Feb;18(2):174-82.
• [32] GDC-9545 (Giredestrant): A Potent and Orally Bioavailable Selective Estrogen Receptor Antagonist and Degrader with an Exceptional Preclinical Profile for ER+ Breast Cancer. J Med Chem. 2021 Aug 26;64(16):11841-11856.
• [33] ClinicalTrials.gov (NCT04975308) EMBER-3: A Phase 3, Randomized, Open-Label Study of Imlunestrant, Investigator's Choice of Endocrine Therapy, and Imlunestrant Plus Abemaciclib in Patients With Estrogen Receptor Positive, HER2 Negative Locally Advanced or Metastatic Breast Cancer Previously Treated With Endocrine Therapy. U.S.National Institutes of Health.
• [34] NM101 Phase III study of NE3107 in Alzheimer's disease: rationale, design?and therapeutic modulation of neuroinflammation and insulin resistance. Neurodegener Dis Manag. 2021 Aug;11(4):289-298.
• [35] ClinicalTrials.gov (NCT01246791) Pharmacokinetics of NPC-01 After Single Oral Administration in Healthy Female Volunteers. U.S. National Institutes of Health.
• [36] Relief of hot flushes with new plant-derived 10-component synthetic conjugated estrogens. Obstet Gynecol. 2004 Feb;103(2):245-53.
• [37] Clinical pipeline report, company report or official report of Pharmabiz.
• [38] Identification of GDC-0810 (ARN-810), an Orally Bioavailable Selective Estrogen Receptor Degrader (SERD) that Demonstrates Robust Activity in Tamoxifen-Resistant Breast Cancer Xenografts. J Med Chem.2015 Jun 25;58(12):4888-904.
• [39] Discovery of AZD9833, a Potent and Orally Bioavailable Selective Estrogen Receptor Degrader and Antagonist. J Med Chem. 2020 Dec 10;63(23):14530-14559.
• [40] Clinical pipeline report, company report or official report of Pantarhei Bioscience.
• [41] Selective estrogen receptor alpha agonist GTx-758 decreases testosterone with reduced side effects of androgen deprivation therapy in men with advanced prostate cancer. Eur Urol. 2015 Feb;67(2):334-41.
• [42] A novel prenylflavone restricts breast cancer cell growth through AhR-mediated destabilization of ER protein.Carcinogenesis.2012 May;33(5):1089-97.
• [43] National Cancer Institute Drug Dictionary (drug id 599816).
• [44] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [45] Clinical pipeline report, company report or official report of Olema Pharmaceuticals.
• [46] Clinical pipeline report, company report or official report of Zentalis Pharmaceuticals.
• [47] Clinical pipeline report, company report or official report of Accutar Biotechnology
• [48] Agents with selective estrogen receptor (ER) modulator activity induce apoptosis in vitro and in vivo in ER-negative glioma cells. Cancer Res. 2004 Dec 15;64(24):9115-23.
• [49] Pharmacological actions of a novel, potent, tissue-selective benzopyran estrogen. J Pharmacol Exp Ther. 2002 Oct;303(1):196-203.
• [50] Clinical pipeline report, company report or official report of InventisBio.
• [51] G1T48, an oral selective estrogen receptor degrader, and the CDK4/6 inhibitor lerociclib inhibit tumor growth in animal models of endocrine-resistant breast cancer. Breast Cancer Res Treat. 2020 Apr;180(3):635-646.
• [52] ClinicalTrials.gov (NCT04647487) A Study of LY3484356 in Women With Breast Cancer Before Having Surgery (EMBER-2). U.S. National Institutes of Health.
• [53] Clinical pipeline report, company report or official report of Sun Pharma Advanced Research Company.
• [54] In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6.
• [55] Inactivation of the uterine estrogen receptor binding of estradiol during P-450 catalyzed metabolism of chlorotrianisene (TACE). Speculation that TACE antiestrogenic activity involves covalent binding to the estrogen receptor. FEBS Lett. 1990 Feb 12;261(1):59-62.
• [56] Bone targeted drugs 2. synthesis of estrogens with hydroxyapatite affinity, Bioorg. Med. Chem. Lett. 6(9):1047-1050 (1996).
• [57] EM-800, a novel antiestrogen, acts as a pure antagonist of the transcriptional functions of estrogen receptors alpha and beta. Endocrinology. 1998 Jan;139(1):111-8.
• [58] Idoxifene: a novel selective estrogen receptor modulator prevents bone loss and lowers cholesterol levels in ovariectomized rats and decreases uterine weight in intact rats. Endocrinology. 1998 Dec;139(12):5224-34.
• [59] Estrogen agonistic/antagonistic effects of miproxifene phosphate (TAT-59)Shibata J1, Toko T, Saito H, Lykkesfeldt AE, Fujioka A, Sato K, Hashimoto A, Wierzba K, Yamada Y.Author information1Hanno Research Center, Taiho Pharmaceutical Co., Ltd., 1-27 Misugidai, Hanno-City, Saitama, 357-8527, Japan.Erratum inCancer Chemother Pharmacol 2000;46(2):172. AbstractPURPOSE: We evaluated miproxifene phosphate (TAT-59) to elucidate its efficacy in antiestrogen therapy for breast cancer patients and to assess its tissue-selective estrogenic/antiestrogenic activity.METHODS: Using DP-TAT-59, a major and active metabolite of TAT-59, an in vitro cell growth inhibition test was performed. Antitumor activity was determined using TAT-59 against human tumor xenografts of the MCF-7 and the Br-10 cell lines andMCF-7-derived tamoxifen-resistant cell lines, R-27 and FST-1. The antitumor activity of DP-TAT-59 and DM-DP-TAT-59, major metabolites of TAT-59 found in human blood following a TAT-59 dose, was also examined after intravenous administration to experimental animals. The residual estrogenic activity of TAT-59, evaluated in terms of bone and lipid metabolism in ovariectomized rats, was then comparedwith that of tamoxifen.RESULTS: DP-TAT-59 significantly inhibited the proliferation of estrogen receptor-positive MCF-7 and T-47D tumor cells in the presence of 1 nM estradiol. TAT-59, given to mice bearing MCF-7 or Br-10 xenografts, at the dose level of 5 mg/kg, exerted a significant growth inhibitory effect that was stronger than that of tamoxifen. Moreover, R-27 and FST-1 tumors, which show a resistance to tamoxifen, responded strongly to TAT-59, suggesting that TAT-59 might be effective against tumors resistant to tamoxifen. The metabolites of TAT-59, DP-TAT-59 and DM-DP-TAT-59, showed similar antitumor activity. Both TAT-59 and tamoxifen suppressed the decrease in bone density and reduced the blood cholesterol levels in ovariectomized rats, suggesting that the estrogenic activity of TAT-59 is comparable to that of tamoxifen.CONCLUSIONS: On the basis of the above results, one may expect TAT-59 to become an effective drug in patients with tumors less sensitive to tamoxifen, while its estrogenic activity as determined by bone and lipid metabolism is similar to that of tamoxifen.PMID: 10663628 [PubMed - indexed for MEDLINE] ShareMeSH Terms, SubstancesMeSH TermsAnimalsAntineoplastic Agents, Hormonal/pharmacologyBreast Neoplasms/pathology*Cell Division/drug effectsDrug Screening Assays, AntitumorEstradiol/pharmacologyEstrogen Antagonists/pharmacology*FemaleHumansLipid MetabolismMiceMice, Inbred BALB CRatsRats, Sprague-DawleyReceptors, Estrogen/physiologyTamoxifen/analogs & derivatives*Tamoxifen/pharmacologyTransplantation, HeterologousTumor Cells, Cultured/drug effectsSubstancesAntineoplastic Agents, HormonalEstrogen AntagonistsReceptors, EstrogenTamoxifenTAT 59EstradiolLinkOut - more resourcesOther Literature SourcesAccess more work from the authors - ResearchGateMedicalBreast Cancer - MedlinePlus Health InformationMiscellaneousESTRADIOL - Hazardous Substances Data BankTAMOXIFEN - Hazardous Substances Data BankPubMed Commons home Cancer Chemother Pharmacol. 2000;45(2):133-41.
• [60] Droloxifene, a new antiestrogen: its role in metastatic breast cancer. Breast Cancer Res Treat. 1994;31(1):83-94.
• [61] Combination therapy for treating breast cancer using antiestrogen, ERA-923, and the mammalian target of rapamycin inhibitor, temsirolimus. Endocr Relat Cancer. 2006 Sep;13(3):863-73.
• [62] Therapeutic targets in dry eye syndrome. Drug News Perspect. 2008 Apr;21(3):166-76.
• [63] Species differences in metabolism of panomifene, an analogue of tamoxifen. Drug Metab Dispos. 1997 Dec;25(12):1370-8.
• [64] CN patent application no. 102406650, Sex steroid precursors alone or in combination with selective estrogen receptor modulator for prevention and treatment of vaginal dryness and sexual dysfunction in postmenop.
• [65] US patent application no. 2010,0278,784, Methods and compositions for treating skin conditions.
• [66] Androstene-3,5-dienes as ER-beta selective SERMs. Bioorg Med Chem Lett. 2007 Nov 15;17(22):6295-8.
• [67] US patent application no. 2010,0278,784, Methods and compositions for treating skin conditions.
• [68] Review of the effects of 17alpha-estradiol in humans: a less feminizing estrogen with neuroprotective potential. Article first published online: 9 FEB 2009.
• [69] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023897)
• [70] Clinical pipeline report, company report or official report of Bionovo.
• [71] Synthesis and biological activity of new halo-steroidal antiestrogens. J Med Chem. 1991 May;34(5):1624-30.
• [72] Structure-activity relationship of antiestrogens. Phenolic analogues of 2,3-diaryl-2H-1-benzopyrans. J Med Chem. 1990 Dec;33(12):3222-9.
• [73] Genomic action of permanently charged tamoxifen derivatives via estrogen receptor-alpha. Bioorg Med Chem. 2010 Aug 1;18(15):5593-601.
• [74] Phase I/II study of the anti-oestrogen zindoxifene (D16726) in the treatment of advanced breast cancer. A Cancer Research Campaign Phase I/II Clinical Trials Committee study.. Br J Cancer. 1990 March; 61(3): 451-453.
• [75] 2-Phenylindole-linked [2-(aminoalkyl)pyridine]dichloroplatinum(II): complexes with a selective action on estrogen receptor positive mammary tumors. J Med Chem. 1991 Jul;34(7):2145-52.
• [76] Differential response of estrogen receptor subtypes to 1,3-diarylindene and 2,3-diarylindene ligands. J Med Chem. 2005 Sep 22;48(19):5989-6003.
• [77] ERbeta ligands. 3. Exploiting two binding orientations of the 2-phenylnaphthalene scaffold to achieve ERbeta selectivity. J Med Chem. 2005 Jun 16;48(12):3953-79.
• [78] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [79] Estrogen receptor beta selective ligands: discovery and SAR of novel heterocyclic ligands. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5562-6.
• [80] Blocking estrogen signaling after the hormone: pyrimidine-core inhibitors of estrogen receptor-coactivator binding. J Med Chem. 2008 Oct 23;51(20):6512-30.
• [81] Design and synthesis of aryl diphenolic azoles as potent and selective estrogen receptor-beta ligands. J Med Chem. 2004 Oct 7;47(21):5021-40.
• [82] 2-Phenylspiroindenes: a novel class of selective estrogen receptor modulators (SERMs). Bioorg Med Chem Lett. 2003 Feb 10;13(3):479-83.
• [83] ERbeta ligands. Part 4: Synthesis and structure-activity relationships of a series of 2-phenylquinoline derivatives. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4520-5.
• [84] 7-Substituted 2-phenyl-benzofurans as ER beta selective ligands. Bioorg Med Chem Lett. 2004 Oct 4;14(19):4925-9.
• [85] Phenolic metabolites of clomiphene: [(E,Z)-2-[4-(1,2-diphenyl-2-chlorovinyl)phenoxy]ethyl]diethylamine. Preparation, electrophilicity, and effects ... J Med Chem. 1989 Jan;32(1):192-7.
• [86] 6H-Benzo[c]chromen-6-one derivatives as selective ERbeta agonists. Bioorg Med Chem Lett. 2006 Mar 15;16(6):1468-72.
• [87] Effects of 7-O substitutions on estrogenic and anti-estrogenic activities of daidzein analogues in MCF-7 breast cancer cells. J Med Chem. 2010 Aug 26;53(16):6153-63.
• [88] Monoaryl-substituted salicylaldoximes as ligands for estrogen receptor beta. J Med Chem. 2008 Mar 13;51(5):1344-51.
• [89] Influence of alkyl chain ramification on estradiol receptor binding affinity and intrinsic activity of 1,2-dialkylated 1,2-bis(4- or 3-hydroxypheny... J Med Chem. 1986 Sep;29(9):1668-74.
• [90] Isolation and structure elucidation of an isoflavone and a sesterterpenoic acid from Henriettella fascicularis. J Nat Prod. 2002 Dec;65(12):1749-53.
• [91] Investigations on estrogen receptor binding. The estrogenic, antiestrogenic, and cytotoxic properties of C2-alkyl-substituted 1,1-bis(4-hydroxyphen... J Med Chem. 2002 Nov 21;45(24):5358-64.
• [92] Synthesis and activity of substituted 4-(indazol-3-yl)phenols as pathway-selective estrogen receptor ligands useful in the treatment of rheumatoid ... J Med Chem. 2004 Dec 16;47(26):6435-8.
• [93] Substituted 4-hydroxyphenyl sulfonamides as pathway-selective estrogen receptor ligands. Bioorg Med Chem Lett. 2006 Feb 15;16(4):854-8.
• [94] Antiestrogenically active 1,1,2-tris(4-hydroxyphenyl)alkenes without basic side chain: synthesis and biological activity. J Med Chem. 2003 Apr 10;46(8):1484-91.
• [95] Estrogen receptor beta ligands: design and synthesis of new 2-phenyl-isoindole-1,3-diones. Bioorg Med Chem Lett. 2007 Jan 1;17(1):118-22.
• [96] Subtle side-chain modifications of the hop phytoestrogen 8-prenylnaringenin result in distinct agonist/antagonist activity profiles for estrogen re... J Med Chem. 2006 Dec 14;49(25):7357-65.
• [97] New estrogenic compounds isolated from Broussonetia kazinoki. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3764-7.
• [98] Utility of boron clusters for drug design. Relation between estrogen receptor binding affinity and hydrophobicity of phenols bearing various types ... Bioorg Med Chem Lett. 2003 Nov 17;13(22):4089-92.
• [99] Structure-based virtual screening for plant-based ERbeta-selective ligands as potential preventative therapy against age-related neurodegenerative ... J Med Chem. 2005 May 19;48(10):3463-6.
• [100] Discovery of potent, nonsteroidal, and highly selective glucocorticoid receptor antagonists. J Med Chem. 2002 Jun 6;45(12):2417-24.
• [101] Synthesis and biological activity of trans-2,3-dihydroraloxifene. Bioorg Med Chem Lett. 1999 Apr 19;9(8):1137-40.
• [102] Design, synthesis, and biological evaluation of doxorubicin-formaldehyde conjugates targeted to breast cancer cells. J Med Chem. 2004 Feb 26;47(5):1193-206.
• [103] Estrogen: estrone (E1), estradiol (E2), estriol (E3) and estetrol (E4). Nihon Rinsho. 2010 Jul;68 Suppl 7:448-61.
• [104] Synthesis and evaluation of geldanamycin-estradiol hybrids. Bioorg Med Chem Lett. 1999 May 3;9(9):1233-8.
• [105] Structure-guided synthesis of tamoxifen analogs with improved selectivity for the orphan ERRgamma. Bioorg Med Chem Lett. 2006 Feb 15;16(4):821-4.
• [106] Molecular mechanism of action at estrogen receptor alpha of a new clinically relevant antiestrogen (GW7604) related to tamoxifen. Endocrinology. 2001 Feb;142(2):838-46.
• [107] Identification and structure-activity relationships of chromene-derived selective estrogen receptor modulators for treatment of postmenopausal symp... J Med Chem. 2009 Dec 10;52(23):7544-69.
• [108] Bicyclo[2.2.2]octanes: close structural mimics of the nuclear receptor-binding motif of steroid receptor coactivators. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4118-22.
• [109] Antagonists selective for estrogen receptor alpha. Endocrinology. 2002 Mar;143(3):941-7.
• [110] Analogs of methyl-piperidinopyrazole (MPP): antiestrogens with estrogen receptor alpha selective activity. Bioorg Med Chem Lett. 2009 Jan 1;19(1):108-10.
• [111] Discovery and preclinical pharmacology of a novel, potent, nonsteroidal estrogen receptor agonist/antagonist, CP-336156, a diaryltetrahydronaphthal... J Med Chem. 1998 Jul 30;41(16):2928-31.
• [112] The selective estrogen receptor alpha agonist Org 37663 induces estrogenic effects but lacks antirheumatic activity: a phase IIa trial investigating efficacy and safety of Org 37663 in postmenopausal female rheumatoid arthritis patients receiving stable background methotrexate or sulfasalazine.Arthritis Rheum.2010 Feb;62(2):351-8.
• [113] Conformational changes and coactivator recruitment by novel ligands for estrogen receptor-alpha and estrogen receptor-beta: correlations with biological character and distinct differences among SRC coactivator family members. Endocrinology. 2000 Oct;141(10):3534-45.
• [114] Novel ligands that function as selective estrogens or antiestrogens for estrogen receptor-alpha or estrogen receptor-beta. Endocrinology. 1999 Feb;140(2):800-4.
• [115] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [116] Synthesis and biological evaluation of stilbene-based pure estrogen antagonists. Bioorg Med Chem Lett. 2004 Sep 20;14(18):4659-63.
• [117] Novel estrogen receptor ligands based on an anthranylaldoxime structure: role of the phenol-type pseudocycle in the binding process. J Med Chem. 2003 Sep 11;46(19):4032-42.