General Information of Drug Off-Target (DOT) (ID: OTIWXGZ9)

DOT Name Superoxide dismutase , mitochondrial (SOD2)
Synonyms EC 1.15.1.1
Gene Name SOD2
Related Disease
Cardiomyopathy ( )
UniProt ID
SODM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1AP5 ; 1AP6 ; 1EM1 ; 1JA8 ; 1LUV ; 1LUW ; 1MSD ; 1N0J ; 1N0N ; 1PL4 ; 1PM9 ; 1QNM ; 1SZX ; 1VAR ; 1XDC ; 1XIL ; 1ZSP ; 1ZTE ; 1ZUQ ; 2ADP ; 2ADQ ; 2GDS ; 2P4K ; 2QKA ; 2QKC ; 3C3S ; 3C3T ; 5GXO ; 5T30 ; 5VF9 ; 7KKS ; 7KKU ; 7KKW ; 7KLB
EC Number
1.15.1.1
Pfam ID
PF02777 ; PF00081
Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Function Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
KEGG Pathway
FoxO sig.ling pathway (hsa04068 )
Peroxisome (hsa04146 )
Longevity regulating pathway (hsa04211 )
Longevity regulating pathway - multiple species (hsa04213 )
Huntington disease (hsa05016 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Detoxification of Reactive Oxygen Species (R-HSA-3299685 )
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models (R-HSA-8862803 )
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505 )
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes (R-HSA-9615017 )
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
BioCyc Pathway
MetaCyc:HS03515-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiomyopathy DISUPZRG Limited Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 13 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Menadione DMSJDTY Approved Superoxide dismutase , mitochondrial (SOD2) decreases the response to substance of Menadione. [93]
Bortezomib DMNO38U Approved Superoxide dismutase , mitochondrial (SOD2) increases the response to substance of Bortezomib. [94]
Mitomycin DMH0ZJE Approved Superoxide dismutase , mitochondrial (SOD2) affects the response to substance of Mitomycin. [95]
Cyclophosphamide DM4O2Z7 Approved Superoxide dismutase , mitochondrial (SOD2) affects the response to substance of Cyclophosphamide. [96]
Methamphetamine DMPM4SK Approved Superoxide dismutase , mitochondrial (SOD2) increases the response to substance of Methamphetamine. [97]
Docetaxel DMDI269 Approved Superoxide dismutase , mitochondrial (SOD2) decreases the response to substance of Docetaxel. [26]
Tacrolimus DMZ7XNQ Approved Superoxide dismutase , mitochondrial (SOD2) increases the response to substance of Tacrolimus. [99]
Epirubicin DMPDW6T Approved Superoxide dismutase , mitochondrial (SOD2) affects the response to substance of Epirubicin. [100]
Dicumarol DMFQCB1 Approved Superoxide dismutase , mitochondrial (SOD2) decreases the response to substance of Dicumarol. [102]
Streptozocin DMOF7AT Approved Superoxide dismutase , mitochondrial (SOD2) decreases the response to substance of Streptozocin. [103]
Steroid derivative 1 DMB0NVQ Patented Superoxide dismutase , mitochondrial (SOD2) increases the response to substance of Steroid derivative 1. [105]
Buthionine sulfoximine DMJ46CB Investigative Superoxide dismutase , mitochondrial (SOD2) increases the response to substance of Buthionine sulfoximine. [98]
Thenoyltrifluoroacetone DM54OKX Investigative Superoxide dismutase , mitochondrial (SOD2) decreases the response to substance of Thenoyltrifluoroacetone. [106]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
This DOT Affected the Regulation of Drug Effects of 6 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Nitric Oxide DM1RBYG Approved Superoxide dismutase , mitochondrial (SOD2) decreases the abundance of Nitric Oxide. [26]
Glutathione DMAHMT9 Approved Superoxide dismutase , mitochondrial (SOD2) increases the abundance of Glutathione. [98]
Urea DMUK75B Approved Superoxide dismutase , mitochondrial (SOD2) decreases the abundance of Urea. [101]
Oxidized glutathione DM9EQC0 Approved Superoxide dismutase , mitochondrial (SOD2) increases the abundance of Oxidized glutathione. [98]
AMG 386 DMQJXL4 Phase 3 Superoxide dismutase , mitochondrial (SOD2) increases the abundance of AMG 386. [101]
Tanespimycin DMNLQHK Phase 2 Superoxide dismutase , mitochondrial (SOD2) increases the abundance of Tanespimycin. [104]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
97 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [3]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Superoxide dismutase , mitochondrial (SOD2). [7]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [8]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Superoxide dismutase , mitochondrial (SOD2). [9]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [10]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [11]
Quercetin DM3NC4M Approved Quercetin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [12]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [13]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Superoxide dismutase , mitochondrial (SOD2). [14]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [15]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Superoxide dismutase , mitochondrial (SOD2). [16]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [17]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Superoxide dismutase , mitochondrial (SOD2). [18]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [19]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [20]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Superoxide dismutase , mitochondrial (SOD2). [21]
Selenium DM25CGV Approved Selenium increases the expression of Superoxide dismutase , mitochondrial (SOD2). [22]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Superoxide dismutase , mitochondrial (SOD2). [23]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [24]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [25]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [26]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [27]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [26]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [19]
Etoposide DMNH3PG Approved Etoposide increases the expression of Superoxide dismutase , mitochondrial (SOD2). [28]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of Superoxide dismutase , mitochondrial (SOD2). [29]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Superoxide dismutase , mitochondrial (SOD2). [30]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [19]
DTI-015 DMXZRW0 Approved DTI-015 decreases the activity of Superoxide dismutase , mitochondrial (SOD2). [31]
Menthol DMG2KW7 Approved Menthol decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [32]
Obeticholic acid DM3Q1SM Approved Obeticholic acid decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [33]
Vinblastine DM5TVS3 Approved Vinblastine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [29]
Ibuprofen DM8VCBE Approved Ibuprofen increases the expression of Superoxide dismutase , mitochondrial (SOD2). [34]
Prednisolone DMQ8FR2 Approved Prednisolone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [19]
Vitamin C DMXJ7O8 Approved Vitamin C increases the expression of Superoxide dismutase , mitochondrial (SOD2). [35]
Rofecoxib DM3P5DA Approved Rofecoxib increases the expression of Superoxide dismutase , mitochondrial (SOD2). [34]
Nefazodone DM4ZS8M Approved Nefazodone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [36]
Dihydroartemisinin DMBXVMZ Approved Dihydroartemisinin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [37]
Methylprednisolone DM4BDON Approved Methylprednisolone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [19]
Bosentan DMIOGBU Approved Bosentan increases the expression of Superoxide dismutase , mitochondrial (SOD2). [38]
Morphine DMRMS0L Approved Morphine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [39]
Atazanavir DMSYRBX Approved Atazanavir increases the expression of Superoxide dismutase , mitochondrial (SOD2). [36]
Bleomycin DMNER5S Approved Bleomycin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [40]
Nifedipine DMSVOZT Approved Nifedipine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [41]
Lapatinib DM3BH1Y Approved Lapatinib increases the expression of Superoxide dismutase , mitochondrial (SOD2). [42]
Epinephrine DM3KJBC Approved Epinephrine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [43]
Norepinephrine DMOUC09 Approved Norepinephrine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [44]
Gallium nitrate DMF9O6B Approved Gallium nitrate decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [45]
Tolcapone DM8MNVO Approved Tolcapone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [46]
Benzbromarone DMC3YUA Approved Benzbromarone increases the expression of Superoxide dismutase , mitochondrial (SOD2). [47]
Mercaptopurine DMTM2IK Approved Mercaptopurine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [48]
Dronedarone DMA8FS5 Approved Dronedarone increases the expression of Superoxide dismutase , mitochondrial (SOD2). [49]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Superoxide dismutase , mitochondrial (SOD2). [50]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [51]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the activity of Superoxide dismutase , mitochondrial (SOD2). [52]
Camptothecin DM6CHNJ Phase 3 Camptothecin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [53]
Coprexa DMA0WEK Phase 3 Coprexa increases the expression of Superoxide dismutase , mitochondrial (SOD2). [54]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin affects the expression of Superoxide dismutase , mitochondrial (SOD2). [55]
Triptolide DMCMDVR Phase 3 Triptolide increases the expression of Superoxide dismutase , mitochondrial (SOD2). [56]
Nabiximols DMHKJ5I Phase 3 Nabiximols decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [57]
NVP-LAQ824 DM8JWNA Phase 3 NVP-LAQ824 increases the expression of Superoxide dismutase , mitochondrial (SOD2). [58]
SNS-595 DMZE2JO Phase 3 SNS-595 increases the activity of Superoxide dismutase , mitochondrial (SOD2). [59]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [60]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [61]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Superoxide dismutase , mitochondrial (SOD2). [62]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Superoxide dismutase , mitochondrial (SOD2). [63]
Disulfiram DMCL2OK Phase 2 Trial Disulfiram increases the expression of Superoxide dismutase , mitochondrial (SOD2). [64]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Superoxide dismutase , mitochondrial (SOD2). [66]
Aminoguanidine DMJQDUC Phase 1 Aminoguanidine decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [67]
Eugenol DM7US1H Patented Eugenol decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [68]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [69]
Flavonoid derivative 1 DMCQP0B Patented Flavonoid derivative 1 increases the expression of Superoxide dismutase , mitochondrial (SOD2). [70]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [71]
SB-431542 DM0YOXQ Preclinical SB-431542 increases the expression of Superoxide dismutase , mitochondrial (SOD2). [72]
Nimesulide DMR1NMD Terminated Nimesulide decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [73]
NS398 DMINUWH Terminated NS398 decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [69]
Acteoside DM0YHKB Terminated Acteoside decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [74]
GGTI-298 DM1CG0J Terminated GGTI-298 increases the expression of Superoxide dismutase , mitochondrial (SOD2). [75]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Superoxide dismutase , mitochondrial (SOD2). [77]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Superoxide dismutase , mitochondrial (SOD2). [78]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Superoxide dismutase , mitochondrial (SOD2). [79]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Superoxide dismutase , mitochondrial (SOD2). [80]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [81]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Superoxide dismutase , mitochondrial (SOD2). [82]
D-glucose DMMG2TO Investigative D-glucose decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [83]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Superoxide dismutase , mitochondrial (SOD2). [84]
Manganese DMKT129 Investigative Manganese increases the expression of Superoxide dismutase , mitochondrial (SOD2). [86]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [87]
Butanoic acid DMTAJP7 Investigative Butanoic acid decreases the activity of Superoxide dismutase , mitochondrial (SOD2). [88]
Forskolin DM6ITNG Investigative Forskolin increases the expression of Superoxide dismutase , mitochondrial (SOD2). [89]
Okadaic acid DM47CO1 Investigative Okadaic acid decreases the expression of Superoxide dismutase , mitochondrial (SOD2). [90]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos affects the expression of Superoxide dismutase , mitochondrial (SOD2). [91]
acrolein DMAMCSR Investigative acrolein increases the expression of Superoxide dismutase , mitochondrial (SOD2). [92]
------------------------------------------------------------------------------------
⏷ Show the Full List of 97 Drug(s)
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Mitoquinone DMKPZ0Q Phase 2 Mitoquinone decreases the response to substance of Superoxide dismutase , mitochondrial (SOD2). [65]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal affects the binding of Superoxide dismutase , mitochondrial (SOD2). [85]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Superoxide dismutase , mitochondrial (SOD2). [76]
------------------------------------------------------------------------------------

References

1 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Mechanism of cisplatin proximal tubule toxicity revealed by integrating transcriptomics, proteomics, metabolomics and biokinetics. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):117-27.
9 Gene expression profiling of human peri-implantation endometria between natural and stimulated cycles. Fertil Steril. 2008 Dec;90(6):2152-64.
10 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
11 Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
12 Cissus quadrangularis ethanol extract upregulates superoxide dismutase, glutathione peroxidase and endothelial nitric oxide synthase expression in hydrogen peroxide-injured human ECV304 cells. J Ethnopharmacol. 2012 Sep 28;143(2):664-72.
13 Inhibition of nuclear factor-kappaB activity by temozolomide involves O6-methylguanine induced inhibition of p65 DNA binding. Cancer Res. 2007 Jul 15;67(14):6889-98.
14 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
15 Neuroprotective effects of glucomoringin-isothiocyanate against H(2)O(2)-Induced cytotoxicity in neuroblastoma (SH-SY5Y) cells. Neurotoxicology. 2019 Dec;75:89-104. doi: 10.1016/j.neuro.2019.09.008. Epub 2019 Sep 12.
16 Suberoylanilide hydroxamic acid combined with gemcitabine enhances apoptosis in non-small cell lung cancer. Surgery. 2005 Aug;138(2):360-7. doi: 10.1016/j.surg.2005.06.016.
17 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
18 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
19 Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
20 Epigenetic regulation of manganese superoxide dismutase expression in human breast cancer cells. Epigenetics. 2006 Oct-Dec;1(4):163-71. doi: 10.4161/epi.1.4.3401. Epub 2006 Sep 13.
21 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
22 Changes in gene expression profiles in response to selenium supplementation among individuals with arsenic-induced pre-malignant skin lesions. Toxicol Lett. 2007 Mar 8;169(2):162-76. doi: 10.1016/j.toxlet.2007.01.006. Epub 2007 Jan 19.
23 Dexamethasone and the inflammatory response in explants of human omental adipose tissue. Mol Cell Endocrinol. 2010 Feb 5;315(1-2):292-8.
24 Higher Concentrations of Folic Acid Cause Oxidative Stress, Acute Cytotoxicity, and Long-Term Fibrogenic Changes in Kidney Epithelial Cells. Chem Res Toxicol. 2022 Nov 21;35(11):2168-2179. doi: 10.1021/acs.chemrestox.2c00258. Epub 2022 Nov 10.
25 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
26 Manganese superoxide dismutase is a promising target for enhancing chemosensitivity of basal-like breast carcinoma. Antioxid Redox Signal. 2014 May 20;20(15):2326-46. doi: 10.1089/ars.2013.5295. Epub 2013 Nov 14.
27 Hydroquinone-induced apoptosis in HL-60 cells. Anticancer Res. 2005 Jan-Feb;25(1A):161-70.
28 Induction of mitochondrial manganese superoxide dismutase confers resistance to apoptosis in acute myeloblastic leukaemia cells exposed to etoposide. Br J Haematol. 2000 Mar;108(3):574-81. doi: 10.1046/j.1365-2141.2000.01852.x.
29 Protein kinase Cdelta-dependent induction of manganese superoxide dismutase gene expression by microtubule-active anticancer drugs. J Biol Chem. 1998 Dec 18;273(51):34639-45. doi: 10.1074/jbc.273.51.34639.
30 Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
31 Proline analogue of nitrosourea as a new cytotoxic prodrug. Arch Pharm (Weinheim). 2009 Nov;342(11):632-9.
32 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
33 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
34 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
35 Pharmacologic concentrations of ascorbic acid cause diverse influence on differential expressions of angiogenic chemokine genes in different hepatocellular carcinoma cell lines. Biomed Pharmacother. 2010 May;64(5):348-51. doi: 10.1016/j.biopha.2009.06.005. Epub 2009 Oct 22.
36 Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
37 Heme synthesis increases artemisinin-induced radical formation and cytotoxicity that can be suppressed by superoxide scavengers. Chem Biol Interact. 2010 Jun 7;186(1):30-5.
38 Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
39 Morphine treatment of human monocyte-derived macrophages induces differential miRNA and protein expression: impact on inflammation and oxidative stress in the central nervous system. J Cell Biochem. 2010 Jul 1;110(4):834-45. doi: 10.1002/jcb.22592.
40 Age-dependent basal level and induction capacity of copper-zinc and manganese superoxide dismutase and other scavenging enzyme activities in leukocytes from young and elderly adults. Am J Pathol. 1993 Jul;143(1):312-20.
41 Nifedipine improves the migratory ability of circulating endothelial progenitor cells depending on manganese superoxide dismutase upregulation. J Hypertens. 2008 Apr;26(4):737-46. doi: 10.1097/HJH.0b013e3282f4d1bd.
42 P450 3A-catalyzed O-dealkylation of lapatinib induces mitochondrial stress and activates Nrf2. Chem Res Toxicol. 2016 May 16;29(5):784-96.
43 Epinephrine upregulates superoxide dismutase in human coronary artery endothelial cells. Free Radic Biol Med. 2001 Jan 15;30(2):148-53.
44 Targeting activation of specific NF-B subunits prevents stress-dependent atherothrombotic gene expression. Mol Med. 2012 Dec 20;18(1):1375-86. doi: 10.2119/molmed.2012.00282.
45 Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
46 The catechol-O-methyltransferase inhibitors tolcapone and entacapone uncouple and inhibit the mitochondrial respiratory chain in HepaRG cells. Toxicol In Vitro. 2017 Aug;42:337-347.
47 Hepatocellular toxicity of benzbromarone: effects on mitochondrial function and structure. Toxicology. 2014 Oct 3;324:136-46. doi: 10.1016/j.tox.2014.08.002. Epub 2014 Aug 7.
48 Petit E, Langouet S, Akhdar H, Nicolas-Nicolaz C, Guillouzo A, Morel F. Differential toxic effects of azathioprine, 6-mercaptopurine and 6-thioguanine on human hepatocytes. Toxicol In Vitro. 2008;22(3):632-642. [PMID: 18222062]
49 Mechanisms of hepatocellular toxicity associated with dronedarone--a comparison to amiodarone. Toxicol Sci. 2013 Feb;131(2):480-90. doi: 10.1093/toxsci/kfs298. Epub 2012 Nov 7.
50 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
51 Effects of hydroxylated resveratrol analogs on oxidative stress and cancer cells death in human acute T cell leukemia cell line: prooxidative potential of hydroxylated resveratrol analogs. Chem Biol Interact. 2014 Feb 25;209:96-110.
52 Green tea catechins alone or in combination alter functional parameters of human neutrophils via suppressing the activation of TLR-4/NFB p65 signal pathway. Toxicol In Vitro. 2015 Oct;29(7):1766-78.
53 Reduced camptothecin sensitivity of estrogen receptor-positive human breast cancer cells following exposure to di(2-ethylhexyl)phthalate (DEHP) is associated with DNA methylation changes. Environ Toxicol. 2019 Apr;34(4):401-414.
54 Copper chelator ATN-224 inhibits endothelial function by multiple mechanisms. Microvasc Res. 2009 May;77(3):314-26.
55 Atorvastatin induces mitochondrial dysfunction and cell apoptosis in HepG2 cells via inhibition of the Nrf2 pathway. J Appl Toxicol. 2019 Oct;39(10):1394-1404. doi: 10.1002/jat.3825. Epub 2019 Aug 18.
56 High-content analysis boosts identification of the initial cause of triptolide-induced hepatotoxicity. J Appl Toxicol. 2019 Sep;39(9):1337-1347. doi: 10.1002/jat.3821. Epub 2019 Jun 19.
57 Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
58 Role of histone deacetylase inhibitor-induced reactive oxygen species and DNA damage in LAQ-824/fludarabine antileukemic interactions. Mol Cancer Ther. 2008 Oct;7(10):3285-97. doi: 10.1158/1535-7163.MCT-08-0385.
59 Vosaroxin induces mitochondrial dysfunction and apoptosis in cervical cancer HeLa cells: Involvement of AMPK/Sirt3/HIF-1 pathway. Chem Biol Interact. 2018 Jun 25;290:57-63. doi: 10.1016/j.cbi.2018.05.011. Epub 2018 May 22.
60 Anti-inflammatory effects of dietary phenolic compounds in an in vitro model of inflamed human intestinal epithelium. Chem Biol Interact. 2010 Dec 5;188(3):659-67.
61 Study on Protection of Human Umbilical Vein Endothelial Cells from Amiodarone-Induced Damage by Intermedin through Activation of Wnt/-Catenin Signaling Pathway. Oxid Med Cell Longev. 2021 Aug 14;2021:8889408. doi: 10.1155/2021/8889408. eCollection 2021.
62 MIP-1beta, a novel biomarker for in vitro sensitization test using human monocytic cell line. Toxicol In Vitro. 2006 Aug;20(5):736-42.
63 Transcriptional activation of the human manganese superoxide dismutase gene mediated by tetradecanoylphorbol acetate. J Biol Chem. 1999 Dec 24;274(52):37455-60. doi: 10.1074/jbc.274.52.37455.
64 Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
65 Mitochondrial redox state regulates transcription of the nuclear-encoded mitochondrial protein manganese superoxide dismutase: a proposed adaptive response to mitochondrial redox imbalance. Free Radic Biol Med. 2005 Mar 1;38(5):644-54. doi: 10.1016/j.freeradbiomed.2004.10.030.
66 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
67 Aminoguanidine impedes human pancreatic tumor growth and metastasis development in nude mice. World J Gastroenterol. 2009 Mar 7;15(9):1065-71.
68 Induction of cytotoxicity and apoptosis and inhibition of cyclooxygenase-2 gene expression by eugenol-related compounds. Anticancer Res. 2005 Sep-Oct;25(5):3263-9.
69 Selective COX-2 inhibitors modulate cellular senescence in human dermal fibroblasts in a catalytic activity-independent manner. Mech Ageing Dev. 2008 Dec;129(12):706-13.
70 Antitumor activity of luteolin in human colon cancer SW620 cells is mediated by the ERK/FOXO3a signaling pathway. Toxicol In Vitro. 2020 Aug;66:104852. doi: 10.1016/j.tiv.2020.104852. Epub 2020 Apr 5.
71 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
72 Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
73 Cyclooxygenase-2 inhibitor, nimesulide, improves radiation treatment against non-small cell lung cancer both in vitro and in vivo. Oncol Rep. 2006 Oct;16(4):771-6.
74 Antioxidant and signal modulation properties of plant polyphenols in controlling vascular inflammation. Eur J Pharmacol. 2011 May 11;658(2-3):248-56.
75 Statin-induced inhibition of breast cancer proliferation and invasion involves attenuation of iron transport: intermediacy of nitric oxide and antioxidant defence mechanisms. FEBS J. 2014 Aug;281(16):3719-38.
76 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
77 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
78 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
79 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
80 In vitro gene expression data supporting a DNA non-reactive genotoxic mechanism for ochratoxin A. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):216-24.
81 The effect of superoxide anion and hydrogen peroxide imbalance on prostate cancer: an integrative in vivo and in vitro analysis. Med Oncol. 2015 Nov;32(11):251.
82 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
83 Proteomic analysis of proteins associated with cellular senescence by calorie restriction in mesenchymal stem cells. In Vitro Cell Dev Biol Anim. 2012 Mar;48(3):186-95.
84 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
85 Proteomic identification of HNE-bound proteins in early Alzheimer disease: Insights into the role of lipid peroxidation in the progression of AD. Brain Res. 2009 Jun 5;1274:66-76. doi: 10.1016/j.brainres.2009.04.009. Epub 2009 Apr 15.
86 Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
87 Transcriptomic profile indicative of immunotoxic exposure: in vitro studies in peripheral blood mononuclear cells. Toxicol Sci. 2010 Nov;118(1):19-30.
88 Oxidative stress involvement in chemically induced differentiation of K562 cells. Free Radic Biol Med. 2000 Jan 1;28(1):18-27.
89 Different mechanisms for the induction of copper-zinc superoxide dismutase and manganese superoxide dismutase by progesterone in human endometrial stromal cells. Hum Reprod. 2002 Jul;17(7):1709-14. doi: 10.1093/humrep/17.7.1709.
90 Evaluation of okadaic acid toxicity in human retinal cells and zebrafish retinas. Toxicology. 2022 May 15;473:153209. doi: 10.1016/j.tox.2022.153209. Epub 2022 May 13.
91 Rosiglitazone inhibits chlorpyrifos-induced apoptosis via modulation of the oxidative stress and inflammatory response in SH-SY5Y cells. Toxicol Appl Pharmacol. 2014 Jul 15;278(2):159-71.
92 Resveratrol stimulates mitochondrial bioenergetics to protect retinal pigment epithelial cells from oxidative damage. Invest Ophthalmol Vis Sci. 2013 Sep 27;54(9):6426-38. doi: 10.1167/iovs.13-12024.
93 Resistance of mitochondrial DNA-depleted cells against cell death: role of mitochondrial superoxide dismutase. J Biol Chem. 2004 Feb 27;279(9):7512-20. doi: 10.1074/jbc.M307677200. Epub 2003 Dec 3.
94 Mechanisms of peripheral neuropathy associated with bortezomib and vincristine in patients with newly diagnosed multiple myeloma: a prospective analysis of data from the HOVON-65/GMMG-HD4 trial. Lancet Oncol. 2010 Nov;11(11):1057-65. doi: 10.1016/S1470-2045(10)70206-0. Epub 2010 Sep 21.
95 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
96 Manganese superoxide dismutase polymorphism, treatment-related toxicity and disease-free survival in SWOG 8897 clinical trial for breast cancer. Breast Cancer Res Treat. 2010 Nov;124(2):433-9. doi: 10.1007/s10549-010-0840-0. Epub 2010 Mar 23.
97 Association analysis of SOD2 variants with methamphetamine psychosis in Japanese and Taiwanese populations. Hum Genet. 2006 Sep;120(2):243-52. doi: 10.1007/s00439-006-0189-y. Epub 2006 Jun 29.
98 Alteration of cellular phenotype and responses to oxidative stress by manganese superoxide dismutase and a superoxide dismutase mimic in RWPE-2 human prostate adenocarcinoma cells. Antioxid Redox Signal. 2004 Jun;6(3):513-22. doi: 10.1089/152308604773934279.
99 Hydrogen peroxide mediates FK506-induced cytotoxicity in renal cells. Kidney Int. 2004 Jan;65(1):139-47. doi: 10.1111/j.1523-1755.2004.00380.x.
100 Endogenous antioxidant enzymes and glutathione S-transferase in protection of mesothelioma cells against hydrogen peroxide and epirubicin toxicity. Br J Cancer. 1998 Apr;77(7):1097-102. doi: 10.1038/bjc.1998.182.
101 Role of peroxynitrite and recombinant human manganese superoxide dismutase in reducing ischemia-reperfusion renal tissue injury. Transplant Proc. 2009 Nov;41(9):3603-10. doi: 10.1016/j.transproceed.2009.04.008.
102 Mitochondrial production of reactive oxygen species mediate dicumarol-induced cytotoxicity in cancer cells. J Biol Chem. 2006 Dec 8;281(49):37416-26. doi: 10.1074/jbc.M605063200. Epub 2006 Oct 13.
103 MnSOD and catalase transgenes demonstrate that protection of islets from oxidative stress does not alter cytokine toxicity. Diabetes. 2005 May;54(5):1437-46. doi: 10.2337/diabetes.54.5.1437.
104 Role for NAD(P)H:quinone oxidoreductase 1 and manganese-dependent superoxide dismutase in 17-(allylamino)-17-demethoxygeldanamycin-induced heat shock protein 90 inhibition in pancreatic cancer cells. J Pharmacol Exp Ther. 2011 Mar;336(3):874-80.
105 Acquisition of resistance of pancreatic cancer cells to 2-methoxyestradiol is associated with the upregulation of manganese superoxide dismutase. Mol Cancer Res. 2012 Jun;10(6):768-77. doi: 10.1158/1541-7786.MCR-11-0378. Epub 2012 Apr 30.
106 Mitochondrial electron-transport-chain inhibitors of complexes I and II induce autophagic cell death mediated by reactive oxygen species. J Cell Sci. 2007 Dec 1;120(Pt 23):4155-66. doi: 10.1242/jcs.011163.