Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0AE1IV)

• DOT Name: Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3)
• Synonyms: EC 6.2.1.2; Acyl-CoA synthetase medium-chain family member 3; Butyrate--CoA ligase 3; Butyryl-coenzyme A synthetase 3; Middle-chain acyl-CoA synthetase 3; Propionate--CoA ligase; EC 6.2.1.17; Protein SA homolog
• Gene Name: ACSM3
• Related Disease:
  Neoplasm
  Arterial disorder
  Autism spectrum disorder
  Brain aneurysm
  Brain cancer
  Brain neoplasm
  Cardiovascular disease
  Cataract
  Chronic kidney disease
  Deafness
  Essential thrombocythemia
  Hepatocellular carcinoma
  Hereditary coproporphyria
  Hydrocephalus
  Hypopituitarism
  Obesity
  Prostate cancer
  Prostate neoplasm
  Sleep disorder
  Type-1/2 diabetes
  Advanced cancer
  Autosomal dominant medullary cystic kidney disease with or without hyperuricemia
  Breast cancer
  Breast carcinoma
  High blood pressure
  Ocular hypertension
  Stroke
  Subarachnoid hemorrhage
  Tetralogy of fallot
  Carcinoma of liver and intrahepatic biliary tract
  Essential hypertension
  Hemosiderosis
  Hyperglycemia
  Liver cancer
  Marfan syndrome
  Post-traumatic stress disorder
  Venous thromboembolism
• UniProt ID: ACSM3_HUMAN
• EC Number: 6.2.1.17; 6.2.1.2
• Pfam ID: PF00501 ; PF13193
• Sequence:
  MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNF
  AKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRG
  DRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPA
  VDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSG
  YPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFT
  HHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCVSAGEPITPDV
  TEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPG
  QEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDV
  ILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIK
  EIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEWKTI
• Function: Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism. Capable of activating medium-chain fatty acids with a preference for isobutyrate among fatty acids with 2-6 carbon atoms.
• KEGG Pathway:
  Butanoate metabolism (hsa00650)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Beta oxidation of butanoyl-CoA to acetyl-CoA (R-HSA-77352)

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Posttranslational Modification	[1]
Arterial disorder	DISLG4XS	Strong	Genetic Variation	[2]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[3]
Brain aneurysm	DISHNW1R	Strong	Biomarker	[4]
Brain cancer	DISBKFB7	Strong	Biomarker	[5]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[5]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[6]
Cataract	DISUD7SL	Strong	Biomarker	[5]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[7]
Deafness	DISKCLH4	Strong	Biomarker	[8]
Essential thrombocythemia	DISWWK11	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[9]
Hereditary coproporphyria	DISDXYP2	Strong	Biomarker	[10]
Hydrocephalus	DISIZUF7	Strong	Biomarker	[11]
Hypopituitarism	DIS1QT3G	Strong	Biomarker	[12]
Obesity	DIS47Y1K	Strong	Genetic Variation	[13]
Prostate cancer	DISF190Y	Strong	Biomarker	[14]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[14]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[15]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[7]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[9]
Autosomal dominant medullary cystic kidney disease with or without hyperuricemia	DIS3PLLZ	moderate	Genetic Variation	[16]
Breast cancer	DIS7DPX1	moderate	Biomarker	[17]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[17]
High blood pressure	DISY2OHH	moderate	Biomarker	[13]
Ocular hypertension	DISC2BT9	moderate	Biomarker	[18]
Stroke	DISX6UHX	moderate	Biomarker	[19]
Subarachnoid hemorrhage	DISI7I8Y	moderate	Biomarker	[20]
Tetralogy of fallot	DISMHFNW	moderate	Biomarker	[19]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Altered Expression	[21]
Essential hypertension	DIS7WI98	Limited	Genetic Variation	[22]
Hemosiderosis	DISPP7QB	Limited	Biomarker	[23]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[24]
Liver cancer	DISDE4BI	Limited	Altered Expression	[21]
Marfan syndrome	DISVEUWZ	Limited	Biomarker	[25]
Post-traumatic stress disorder	DISHL1EY	Limited	Biomarker	[26]
Venous thromboembolism	DISUR7CR	Limited	Biomarker	[27]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[28]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[32]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[29]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[33]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[34]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[35]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[36]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[37]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[35]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[33]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[39]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3).	[40]

References

• [1] The Transsulfuration Pathway Makes, the Tumor Takes.Cell Metab. 2019 Nov 5;30(5):845-846. doi: 10.1016/j.cmet.2019.10.009.
• [2] Specific mechanisms of subarachnoid hemorrhage accompanied by ischemic stroke in essential thrombocythemia: two case reports and a literature review.J Neurol. 2019 Aug;266(8):1869-1878. doi: 10.1007/s00415-019-09347-4. Epub 2019 May 2.
• [3] Prenatal Nutritional Intervention Reduces Autistic-Like Behavior Rates Among Mthfr-Deficient Mice.Front Neurosci. 2019 May 2;13:383. doi: 10.3389/fnins.2019.00383. eCollection 2019.
• [4] Smoking and family history and risk of aneurysmal subarachnoid hemorrhage.Neurology. 2009 Jan 6;72(1):69-72. doi: 10.1212/01.wnl.0000338567.90260.46.
• [5] Effects of Radiation Exposure on the Cost-Effectiveness of CT Angiography and Perfusion Imaging in Aneurysmal Subarachnoid Hemorrhage.AJNR Am J Neuroradiol. 2017 Mar;38(3):462-468. doi: 10.3174/ajnr.A5034. Epub 2017 Jan 12.
• [6] Adverse lipid profile elevates risk for subarachnoid hemorrhage: Aprospective population-based cohort study.Atherosclerosis. 2018 Jul;274:112-119. doi: 10.1016/j.atherosclerosis.2018.05.011. Epub 2018 May 5.
• [7] Descriptive Study of Aneurysmal and Nonaneurysmal Subarachnoid Hemorrhage and the Role of Confirmative Digital Subtraction Angiography in Patients with Nonaneurysmal Subarachnoid in Puerto Rico.World Neurosurg. 2020 Feb;134:e481-e486. doi: 10.1016/j.wneu.2019.10.104. Epub 2019 Oct 28.
• [8] Subjective hearing impairment after subarachnoid haemorrhage: Prevalence and risk factors.J Neurol Sci. 2017 Jan 15;372:184-186. doi: 10.1016/j.jns.2016.11.062. Epub 2016 Nov 24.
• [9] Downregulation of ACSM3 promotes metastasis and predicts poor prognosis in hepatocellular carcinoma.Am J Cancer Res. 2017 Mar 1;7(3):543-553. eCollection 2017.
• [10] Hydrocephalus after Subarachnoid Hemorrhage: Pathophysiology, Diagnosis, and Treatment.Biomed Res Int. 2017;2017:8584753. doi: 10.1155/2017/8584753. Epub 2017 Mar 8.
• [11] Validation of a Predictive Scoring System for Ventriculoperitoneal Shunt Insertion After Aneurysmal Subarachnoid Hemorrhage.World Neurosurg. 2018 Jan;109:e210-e216. doi: 10.1016/j.wneu.2017.09.140. Epub 2017 Sep 28.
• [12] MANAGEMENT OF ENDOCRINE DISEASE: Neuroendocrine surveillance and management of neurosurgical patients.Eur J Endocrinol. 2017 May;176(5):R217-R233. doi: 10.1530/EJE-16-0962. Epub 2017 Feb 13.
• [13] Left ventricular structure in relation to the human SAH gene in the European Project on Genes in Hypertension.Hypertens Res. 2009 Feb;32(2):145-51. doi: 10.1038/hr.2008.30. Epub 2009 Jan 16.
• [14] Microarray comparison of prostate tumor gene expression in African-American and Caucasian American males: a pilot project study.Infect Agent Cancer. 2009 Feb 10;4 Suppl 1(Suppl 1):S3. doi: 10.1186/1750-9378-4-S1-S3.
• [15] Increased risk for subarachnoid hemorrhage in patients with sleep apnea.J Neurol. 2019 Jun;266(6):1351-1357. doi: 10.1007/s00415-019-09265-5. Epub 2019 Mar 5.
• [16] Molecular analysis of uromodulin and SAH genes, positional candidates for autosomal dominant medullary cystic kidney disease linked to 16p12.J Nephrol. 2001 Sep-Oct;14(5):392-6.
• [17] Metabolic Studies of Tumor Cells Using [1-(13) C] Pyruvate Hyperpolarized by Means of PHIP-Side Arm Hydrogenation.Chemphyschem. 2019 Jan 21;20(2):318-325. doi: 10.1002/cphc.201800652. Epub 2018 Oct 24.
• [18] Retinal gene profiling in a hereditary rodent model of elevated intraocular pressure.Mol Vis. 2006 Oct 18;12:1199-210.
• [19] Subarachnoid Hemorrhage Attributable to Bilateral Aplastic or Twiglike Middle Cerebral Artery.World Neurosurg. 2020 Feb;134:560-563. doi: 10.1016/j.wneu.2019.10.054. Epub 2019 Oct 16.
• [20] External Validation of the Subarachnoid Hemorrhage International Trialists (SAHIT) Predictive Model Using the Barrow Ruptured Aneurysm Trial (BRAT) Cohort.Neurosurgery. 2020 Jan 1;86(1):101-106. doi: 10.1093/neuros/nyy600.
• [21] Integrative transcriptome analysis of liver cancer profiles identifies upstream regulators and clinical significance of ACSM3 gene expression.Cell Oncol (Dordr). 2017 Jun;40(3):219-233. doi: 10.1007/s13402-017-0321-0. Epub 2017 Apr 7.
• [22] Two medium-chain acyl-coenzyme A synthetase genes, SAH and MACS1, are associated with plasma high-density lipoprotein cholesterol levels, but they are not associated with essential hypertension.J Hypertens. 2004 Oct;22(10):1903-7. doi: 10.1097/00004872-200410000-00012.
• [23] Effects of Hemosiderosis on Epilepsy Following Subarachnoid Hemorrhage.Neurol Med Chir (Tokyo). 2019 Jan 15;59(1):27-32. doi: 10.2176/nmc.oa.2018-0125. Epub 2018 Dec 18.
• [24] Elevated glycated hemoglobin level and hyperglycemia after aneurysmal subarachnoid hemorrhage.Clin Neurol Neurosurg. 2017 Dec;163:128-132. doi: 10.1016/j.clineuro.2017.10.037. Epub 2017 Oct 31.
• [25] Increased Prevalence of Cerebrovascular Disease in Hospitalized Patients with Marfan Syndrome.J Stroke Cerebrovasc Dis. 2018 Feb;27(2):296-300. doi: 10.1016/j.jstrokecerebrovasdis.2017.08.036. Epub 2017 Oct 10.
• [26] PTSD symptoms predict outcome in trauma-informed treatment of intimate partner aggression.J Consult Clin Psychol. 2017 Oct;85(10):966-974. doi: 10.1037/ccp0000228. Epub 2017 Jul 20.
• [27] Low-Dose versus Therapeutic Range Intravenous Unfractionated Heparin Prophylaxis in the Treatment of Patients with Severe Aneurysmal Subarachnoid Hemorrhage After Aneurysm Occlusion.World Neurosurg. 2018 Sep;117:e705-e711. doi: 10.1016/j.wneu.2018.06.118. Epub 2018 Jun 27.
• [28] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [29] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [30] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [31] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [34] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [35] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [36] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [37] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [38] BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
• [39] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [40] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.