Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT24078H)

• DOT Name: Collagen alpha-1(V) chain (COL5A1)
• Synonyms: Collagen alpha-1(V) chain
• Gene Name: COL5A1
• Related Disease:
  Connective tissue disorder
  Ehlers-Danlos syndrome, classic type
  Advanced cancer
  Autoimmune lymphoproliferative syndrome type 2B
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Carpal tunnel syndrome
  Coagulation defect
  Dilated cardiomyopathy 1A
  Ehlers-Danlos syndrome
  Ehlers-Danlos syndrome, classic type, 1
  Ehlers-Danlos syndrome, classic type, 2
  Epithelial ovarian cancer
  Gastric cancer
  Head-neck squamous cell carcinoma
  Hereditary hemorrhagic telangiectasia
  Inflammatory breast cancer
  Invasive ductal breast carcinoma
  Keloid
  Keratoconus
  Lung adenocarcinoma
  Nail-patella syndrome
  OPTN-related open angle glaucoma
  Osteogenesis imperfecta
  Ovarian cancer
  Ovarian neoplasm
  Prostate cancer
  Prostate neoplasm
  Stomach cancer
  Tuberous sclerosis 1
  Clear cell renal carcinoma
  Meningioma
  Neoplasm
  Tendinopathy
  Metastatic malignant neoplasm
  Arterial disorder
  Bronchiolitis
  Carcinoma
  Musculoskeletal disorder
  Renal cell carcinoma
  Undifferentiated carcinoma
• UniProt ID: CO5A1_HUMAN
• PDB ID: 7Y37
• Pfam ID: PF01410 ; PF01391 ; PF02210
• Sequence:
  MDVHTRWKARSALRPGAPLLPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTG
  FCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY
  NEQGIQQIGLELGRSPVFLYEDHTGKPGPEDYPLFRGINLSDGKWHRIALSVHKKNVTLI
  LDCKKKTTKFLDRSDHPMIDINGIIVFGTRILDEEVFEGDIQQLLFVSDHRAAYDYCEHY
  SPDCDTAVPDTPQSQDPNPDEYYTEGDGEGETYYYEYPYYEDPEDLGKEPTPSKKPVEAA
  KETTEVPEELTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTYGEG
  EENPDQPTDPGAGAEIPTSTADTSNSSNPAPPPGEGADDLEGEFTEETIRNLDENYYDPY
  YDPTSSPSEIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLP
  GPPGTMGPTGQVGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPMVS
  AQESQAQAILQQARLALRGPAGPMGLTGRPGPVGPPGSGGLKGEPGDVGPQGPRGVQGPP
  GPAGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGPPGDD
  GERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQPGPKGNVGPQGEPGPP
  GQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPP
  GPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGED
  GPEGPKGRGGPNGDPGPLGPPGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGR
  GTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGERGPNGPQGPTGFP
  GPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPP
  GPPGEQGLPGLAGKEGTKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGNEGPP
  GPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGLQGPV
  GLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADGEP
  GPRGQQGLFGQKGDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPS
  GAPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPGLPGEGGPPGPKGERGEKGESGPSGAA
  GPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPT
  GEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLR
  GIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEK
  GDRGLPGPQGSSGPKGEQGITGPSGPIGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAGHP
  GPPGPPGPPGEVIQPLPIQASRTRRNIDASQLLDDGNGENYVDYADGMEEIFGSLNSLKL
  EIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGSTC
  VFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASAHQ
  NVTYHCYQSVAWQDAATGSYDKALRFLGSNDEEMSYDNNPYIRALVDGCATKKGYQKTVL
  EIDTPKVEQVPIVDIMFNDFGEASQKFGFEVGPACFMG
• Function: Type V collagen is a member of group I collagen (fibrillar forming collagen). It is a minor connective tissue component of nearly ubiquitous distribution. Type V collagen binds to DNA, heparan sulfate, thrombospondin, heparin, and insulin.
• KEGG Pathway:
  Cytoskeleton in muscle cells (hsa04820)
  Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Extracellular matrix organization (R-HSA-1474244)
  Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
  Signaling by PDGF (R-HSA-186797)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Integrin cell surface interactions (R-HSA-216083)
  Syndecan interactions (R-HSA-3000170)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  NCAM1 interactions (R-HSA-419037)
  MET activates PTK2 signaling (R-HSA-8874081)
  Collagen chain trimerization (R-HSA-8948216)
  Collagen degradation (R-HSA-1442490)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Connective tissue disorder	DISKXBS3	Definitive	Genetic Variation	[1]
Ehlers-Danlos syndrome, classic type	DISKOTBA	Definitive	Autosomal dominant	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Autoimmune lymphoproliferative syndrome type 2B	DIS7EXGM	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[5]
Carpal tunnel syndrome	DISHQ3BE	Strong	Genetic Variation	[6]
Coagulation defect	DIS9X3H6	Strong	Biomarker	[7]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[8]
Ehlers-Danlos syndrome	DISSVBRR	Strong	Genetic Variation	[9]
Ehlers-Danlos syndrome, classic type, 1	DIS4BR9L	Strong	Autosomal dominant	[10]
Ehlers-Danlos syndrome, classic type, 2	DISNDKU3	Strong	Biomarker	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[3]
Gastric cancer	DISXGOUK	Strong	Biomarker	[12]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[13]
Hereditary hemorrhagic telangiectasia	DISXTDNT	Strong	Biomarker	[14]
Inflammatory breast cancer	DIS3QRWA	Strong	Biomarker	[15]
Invasive ductal breast carcinoma	DIS43J58	Strong	Altered Expression	[8]
Keloid	DISV09JY	Strong	Biomarker	[16]
Keratoconus	DISOONXH	Strong	Genetic Variation	[17]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[18]
Nail-patella syndrome	DIS8C4CT	Strong	Biomarker	[14]
OPTN-related open angle glaucoma	DISDR98A	Strong	Biomarker	[19]
Osteogenesis imperfecta	DIS7XQSD	Strong	Genetic Variation	[9]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[3]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[3]
Prostate cancer	DISF190Y	Strong	Biomarker	[20]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[20]
Stomach cancer	DISKIJSX	Strong	Biomarker	[12]
Tuberous sclerosis 1	DIS07GDN	Strong	Biomarker	[14]
Clear cell renal carcinoma	DISBXRFJ	moderate	Altered Expression	[21]
Meningioma	DISPT4TG	moderate	Altered Expression	[22]
Neoplasm	DISZKGEW	moderate	Altered Expression	[21]
Tendinopathy	DISJH7UX	moderate	Genetic Variation	[23]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Altered Expression	[24]
Arterial disorder	DISLG4XS	Limited	Autosomal dominant	[25]
Bronchiolitis	DISEE9BG	Limited	Biomarker	[26]
Carcinoma	DISH9F1N	Limited	Biomarker	[27]
Musculoskeletal disorder	DISPPN0O	Limited	Genetic Variation	[28]
Renal cell carcinoma	DISQZ2X8	Limited	Altered Expression	[29]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[27]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[30]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Collagen alpha-1(V) chain (COL5A1).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[35]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[36]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[31]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Collagen alpha-1(V) chain (COL5A1).	[38]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[39]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Collagen alpha-1(V) chain (COL5A1).	[40]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[41]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Collagen alpha-1(V) chain (COL5A1).	[42]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Collagen alpha-1(V) chain (COL5A1).	[43]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Collagen alpha-1(V) chain (COL5A1).	[44]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate increases the expression of Collagen alpha-1(V) chain (COL5A1).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Collagen alpha-1(V) chain (COL5A1).	[46]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[36]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[48]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Collagen alpha-1(V) chain (COL5A1).	[51]
Paraquat	DMR8O3X	Investigative	Paraquat affects the expression of Collagen alpha-1(V) chain (COL5A1).	[31]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[48]
PFI-1	DMVFK3J	Investigative	PFI-1 decreases the expression of Collagen alpha-1(V) chain (COL5A1).	[48]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Collagen alpha-1(V) chain (COL5A1).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Collagen alpha-1(V) chain (COL5A1).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Collagen alpha-1(V) chain (COL5A1).	[50]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the methylation of Collagen alpha-1(V) chain (COL5A1).	[52]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
D-glucose	DMMG2TO	Investigative	D-glucose affects the secretion of Collagen alpha-1(V) chain (COL5A1).	[53]

References

• [1] Are the nail-patella syndrome and the autosomal Goltz-like syndrome the phenotypic expressions of different alleles at the COL5A1 locus?.Hum Genet. 1993 Mar;91(2):175-7. doi: 10.1007/BF00222720.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Prospective molecular mechanism of COL5A1 in breast cancer based on a microarray, RNA sequencing and immunohistochemistry.Oncol Rep. 2019 Jul;42(1):151-175. doi: 10.3892/or.2019.7147. Epub 2019 May 3.
• [4] Mutations in the COL5A1 gene are causal in the Ehlers-Danlos syndromes I and II.Am J Hum Genet. 1997 Mar;60(3):547-54.
• [5] Genetic architecture of human plasma lipidome and its link to cardiovascular disease.Nat Commun. 2019 Sep 24;10(1):4329. doi: 10.1038/s41467-019-11954-8.
• [6] The COL5A1 gene is associated with increased risk of carpal tunnel syndrome.Clin Rheumatol. 2015 Apr;34(4):767-74. doi: 10.1007/s10067-014-2727-7. Epub 2014 Jun 26.
• [7] Familial Ehlers-Danlos syndrome with lethal arterial events caused by a mutation in COL5A1.Am J Med Genet A. 2015 Jun;167(6):1196-203. doi: 10.1002/ajmg.a.36997. Epub 2015 Apr 2.
• [8] Overexpression of collagen type V 1 chain in human breast invasive ductal carcinoma is mediated by TGF-1.Int J Oncol. 2018 May;52(5):1694-1704. doi: 10.3892/ijo.2018.4317. Epub 2018 Mar 15.
• [9] Compound phenotype of osteogenesis imperfecta and Ehlers-Danlos syndrome caused by combined mutations in COL1A1 and COL5A1.Biosci Rep. 2019 Jul 25;39(7):BSR20181409. doi: 10.1042/BSR20181409. Print 2019 Jul 31.
• [10] Clinical and molecular characterization of 40 patients with classic Ehlers-Danlos syndrome: identification of 18 COL5A1 and 2 COL5A2 novel mutations. Orphanet J Rare Dis. 2013 Apr 12;8:58. doi: 10.1186/1750-1172-8-58.
• [11] A point mutation in an intronic branch site results in aberrant splicing of COL5A1 and in Ehlers-Danlos syndrome type II in two British families.Am J Hum Genet. 1998 Aug;63(2):390-8. doi: 10.1086/301948.
• [12] Discovery of signature genes in gastric cancer associated with prognosis.Neoplasma. 2016;63(2):239-45. doi: 10.4149/209_150531N303.
• [13] Subpath analysis of each subtype of head and neck cancer based on the regulatory relationship between miRNAs and biological pathways.Oncol Rep. 2015 Oct;34(4):1745-54. doi: 10.3892/or.2015.4150. Epub 2015 Jul 24.
• [14] COL5A1: fine genetic mapping and exclusion as candidate gene in families with nail-patella syndrome, tuberous sclerosis 1, hereditary hemorrhagic telangiectasia, and Ehlers-Danlos Syndrome type II.Genomics. 1995 Feb 10;25(3):737-9. doi: 10.1016/0888-7543(95)80021-d.
• [15] Systematically identify key genes in inflammatory and non-inflammatory breast cancer.Gene. 2016 Jan 10;575(2 Pt 3):600-14. doi: 10.1016/j.gene.2015.09.025. Epub 2015 Sep 25.
• [16] Comparative proteomic analysis between normal skin and keloid scar.Br J Dermatol. 2010 Jun;162(6):1302-15. doi: 10.1111/j.1365-2133.2010.09660.x. Epub 2010 Feb 1.
• [17] Evaluating the Association between Keratoconus and Reported Genetic Loci in a Han Chinese Population.Ophthalmic Genet. 2015 Jun;36(2):132-6. doi: 10.3109/13816810.2015.1005317. Epub 2015 Feb 12.
• [18] COL5A1 may contribute the metastasis of lung adenocarcinoma.Gene. 2018 Jul 30;665:57-66. doi: 10.1016/j.gene.2018.04.066. Epub 2018 Apr 24.
• [19] Identification of genes associated with primary open-angle glaucoma by bioinformatics approach.Int Ophthalmol. 2018 Feb;38(1):19-28. doi: 10.1007/s10792-017-0704-2. Epub 2017 Sep 11.
• [20] The long tail of oncogenic drivers in prostate cancer.Nat Genet. 2018 May;50(5):645-651. doi: 10.1038/s41588-018-0078-z. Epub 2018 Apr 2.
• [21] Overexpression of COL5A1 promotes tumor progression and metastasis and correlates with poor survival of patients with clear cell renal cell carcinoma.Cancer Manag Res. 2019 Feb 7;11:1263-1274. doi: 10.2147/CMAR.S188216. eCollection 2019.
• [22] miRNA-145 is downregulated in atypical and anaplastic meningiomas and negatively regulates motility and proliferation of meningioma cells.Oncogene. 2013 Sep 26;32(39):4712-20. doi: 10.1038/onc.2012.468. Epub 2012 Oct 29.
• [23] Variants within the MMP3 gene are associated with Achilles tendinopathy: possible interaction with the COL5A1 gene.Br J Sports Med. 2009 Jul;43(7):514-20. doi: 10.1136/bjsm.2008.053892. Epub 2008 Nov 28.
• [24] Cancer-associated stroma significantly contributes to the mesenchymal subtype signature of serous ovarian cancer.Gynecol Oncol. 2019 Feb;152(2):368-374. doi: 10.1016/j.ygyno.2018.11.014. Epub 2018 Nov 15.
• [25] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [26] IL-17-dependent cellular immunity to collagen type V predisposes to obliterative bronchiolitis in human lung transplants.J Clin Invest. 2007 Nov;117(11):3498-506. doi: 10.1172/JCI28031.
• [27] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [28] The BstUI and DpnII Variants of the COL5A1 Gene Are Associated With Tennis Elbow.Am J Sports Med. 2015 Jul;43(7):1784-9. doi: 10.1177/0363546515578661. Epub 2015 Apr 20.
• [29] Identification of potential core genes in metastatic renal cell carcinoma using bioinformatics analysis.Am J Transl Res. 2019 Nov 15;11(11):6812-6825. eCollection 2019.
• [30] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [31] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [32] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [33] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [34] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [35] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [36] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [37] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [38] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [39] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [40] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [41] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [42] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [43] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [44] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [45] Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
• [46] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] BRD4 is a novel therapeutic target for liver fibrosis. Proc Natl Acad Sci U S A. 2015 Dec 22;112(51):15713-8. doi: 10.1073/pnas.1522163112. Epub 2015 Dec 7.
• [49] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [50] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [51] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [52] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [53] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.