Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2Q71VQ)

DOT Name UDP-glucuronosyltransferase 2B7
Synonyms UDPGT 2B7; UGT2B7; EC 2.4.1.17; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronosyltransferase 2B9; UDPGT 2B9; UDPGTh-2
Gene Name UGT2B7
UniProt ID
UD2B7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2O6L
EC Number
2.4.1.17
Pfam ID
PF00201
Sequence
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND
Function
UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol, estriol, catechol estrogens). Also regulates the levels of retinoic acid, a major metabolite of vitamin A involved in apoptosis, cellular growth and differentiation, and embryonic development. Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, caderastan and zolarsatan, drugs which can inhibit the effect of angiotensin II. Also metabolizes mycophenolate, an immunosuppressive agent.
KEGG Pathway
Pentose and glucuro.te interconversions (hsa00040 )
Ascorbate and aldarate metabolism (hsa00053 )
Steroid hormone biosynthesis (hsa00140 )
Retinol metabolism (hsa00830 )
Porphyrin metabolism (hsa00860 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Biosynthesis of cofactors (hsa01240 )
Bile secretion (hsa04976 )
Chemical carcinogenesis - D. adducts (hsa05204 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Reactome Pathway
Aspirin ADME (R-HSA-9749641 )
Prednisone ADME (R-HSA-9757110 )
Glucuronidation (R-HSA-156588 )
BioCyc Pathway
MetaCyc:HS10272-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Biotransformations of 42 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Estradiol. [26]
Diethylstilbestrol DMN3UXQ Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Diethylstilbestrol. [27]
Diclofenac DMPIHLS Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Diclofenac. [28]
Indomethacin DMSC4A7 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Indomethacin. [29]
Menthol DMG2KW7 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Menthol. [30]
Ethinyl estradiol DMODJ40 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Ethinyl estradiol. [31]
Sulindac DM2QHZU Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Sulindac. [32]
Ibuprofen DM8VCBE Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Ibuprofen. [29]
Ursodeoxycholic acid DMCUT21 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Ursodeoxycholic acid. [33]
Estrone DM5T6US Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Estrone. [26]
Morphine DMRMS0L Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Morphine. [30]
Estriol DMOEM2I Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Estriol. [29]
Flurbiprofen DMGN4BY Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Flurbiprofen. [32]
Carvedilol DMHTEAO Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Carvedilol. [35]
Naproxen DMZ5RGV Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Naproxen. [29]
Etodolac DM6WJO9 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Etodolac. [36]
Aldosterone DM9S2JW Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Aldosterone. [37]
Ketoprofen DMRKXPT Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Ketoprofen. [29]
Ezetimibe DM7A8TW Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Ezetimibe. [38]
Naloxone DM3FXMA Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Naloxone. [40]
Fenoprofen DML5VQ0 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Fenoprofen. [29]
Diflunisal DM7EN8I Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Diflunisal. [29]
Oxazepam DMXNZM4 Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Oxazepam. [42]
Amobarbital DM0GQ8N Approved UDP-glucuronosyltransferase 2B7 increases the glycosylation of Amobarbital. [43]
Tiaprofenic acid DM23D7J Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Tiaprofenic acid. [29]
Denopamine DM8C3GN Approved UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Denopamine. [28]
LAROPIPRANT DM5FABJ Phase 4 UDP-glucuronosyltransferase 2B7 increases the glucuronidation of LAROPIPRANT. [44]
EXISULIND DMBY56U Phase 3 UDP-glucuronosyltransferase 2B7 increases the glucuronidation of EXISULIND. [32]
Ranirestat DMD5QRS Phase 3 UDP-glucuronosyltransferase 2B7 increases the glycosylation of Ranirestat. [43]
Zomepirac DM7APNJ Withdrawn from market UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Zomepirac. [29]
Benoxaprofen DM5ZOX8 Withdrawn from market UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Benoxaprofen. [29]
Bisphenol A DM2ZLD7 Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Bisphenol A. [45]
Arachidonic acid DMUOQZD Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Arachidonic acid. [46]
BRN-3548355 DM4KXT0 Investigative UDP-glucuronosyltransferase 2B7 decreases the glucuronidation of BRN-3548355. [47]
Farnesol DMV2X1B Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Farnesol. [48]
Tetramethylbutylphenol DMW9CH2 Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Tetramethylbutylphenol. [49]
Fibrates DMFNTMY Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Fibrates. [29]
ACMC-1AKLT DMRQ70X Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of ACMC-1AKLT. [50]
20-HETE DM5BAJ9 Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of 20-HETE. [46]
BRN-1999480 DMC9Q4D Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of BRN-1999480. [29]
Diclofenac glucuronide DMWADLM Investigative UDP-glucuronosyltransferase 2B7 affects the chemical synthesis of Diclofenac glucuronide. [51]
Hyodeoxycholic acid DMSIWD0 Investigative UDP-glucuronosyltransferase 2B7 increases the glucuronidation of Hyodeoxycholic acid. [29]
------------------------------------------------------------------------------------
⏷ Show the Full List of 42 Drug(s)
This DOT Affected the Drug Response of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Bezafibrate DMZDCS0 Approved UDP-glucuronosyltransferase 2B7 increases the response to substance of Bezafibrate. [34]
Probenecid DMMFWOJ Approved UDP-glucuronosyltransferase 2B7 affects the response to substance of Probenecid. [34]
Topiramate DM82Z30 Approved UDP-glucuronosyltransferase 2B7 affects the response to substance of Topiramate. [39]
Brilinta DMBR01X Approved UDP-glucuronosyltransferase 2B7 increases the Acute coronary syndrome ADR of Brilinta. [41]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of UDP-glucuronosyltransferase 2B7. [1]
------------------------------------------------------------------------------------
34 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of UDP-glucuronosyltransferase 2B7. [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of UDP-glucuronosyltransferase 2B7. [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of UDP-glucuronosyltransferase 2B7. [4]
Quercetin DM3NC4M Approved Quercetin decreases the activity of UDP-glucuronosyltransferase 2B7. [5]
Testosterone DM7HUNW Approved Testosterone increases the expression of UDP-glucuronosyltransferase 2B7. [6]
Triclosan DMZUR4N Approved Triclosan increases the expression of UDP-glucuronosyltransferase 2B7. [7]
Phenobarbital DMXZOCG Approved Phenobarbital decreases the expression of UDP-glucuronosyltransferase 2B7. [8]
Folic acid DMEMBJC Approved Folic acid decreases the expression of UDP-glucuronosyltransferase 2B7. [9]
Obeticholic acid DM3Q1SM Approved Obeticholic acid decreases the expression of UDP-glucuronosyltransferase 2B7. [10]
Zidovudine DM4KI7O Approved Zidovudine decreases the expression of UDP-glucuronosyltransferase 2B7. [11]
Chenodiol DMQ8JIK Approved Chenodiol decreases the expression of UDP-glucuronosyltransferase 2B7. [12]
Osimertinib DMRJLAT Approved Osimertinib decreases the activity of UDP-glucuronosyltransferase 2B7. [13]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of UDP-glucuronosyltransferase 2B7. [14]
3,4-Dihydroxycinnamic Acid DMVZL26 Phase 4 3,4-Dihydroxycinnamic Acid decreases the activity of UDP-glucuronosyltransferase 2B7. [15]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of UDP-glucuronosyltransferase 2B7. [16]
Androsterone DMITJAK Phase 3 Androsterone decreases the activity of UDP-glucuronosyltransferase 2B7. [17]
LM-94 DMW3QGJ Phase 1/2 LM-94 increases the activity of UDP-glucuronosyltransferase 2B7. [17]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of UDP-glucuronosyltransferase 2B7. [18]
EMODIN DMAEDQG Terminated EMODIN decreases the expression of UDP-glucuronosyltransferase 2B7. [19]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of UDP-glucuronosyltransferase 2B7. [20]
Kaempferol DMHEMUB Investigative Kaempferol decreases the activity of UDP-glucuronosyltransferase 2B7. [5]
CATECHIN DMY38SB Investigative CATECHIN decreases the activity of UDP-glucuronosyltransferase 2B7. [15]
(E)-4-(3,5-dimethoxystyryl)phenol DMYXI2V Investigative (E)-4-(3,5-dimethoxystyryl)phenol decreases the activity of UDP-glucuronosyltransferase 2B7. [21]
2-tert-butylbenzene-1,4-diol DMNXI1E Investigative 2-tert-butylbenzene-1,4-diol increases the expression of UDP-glucuronosyltransferase 2B7. [22]
Myricetin DMTV4L0 Investigative Myricetin decreases the activity of UDP-glucuronosyltransferase 2B7. [5]
Chlorogenic acid DM2Y3P4 Investigative Chlorogenic acid decreases the activity of UDP-glucuronosyltransferase 2B7. [15]
Morin DM2OGZ5 Investigative Morin decreases the activity of UDP-glucuronosyltransferase 2B7. [5]
Galangin DM5TQ2O Investigative Galangin decreases the activity of UDP-glucuronosyltransferase 2B7. [5]
MANGIFERIN DMWAF5Z Investigative MANGIFERIN decreases the activity of UDP-glucuronosyltransferase 2B7. [23]
P-Coumaric Acid DMGJSVD Investigative P-Coumaric Acid decreases the activity of UDP-glucuronosyltransferase 2B7. [15]
EPZ-004777 DMLN4V5 Investigative EPZ-004777 increases the expression of UDP-glucuronosyltransferase 2B7. [24]
Phloretin DMYA50U Investigative Phloretin decreases the activity of UDP-glucuronosyltransferase 2B7. [15]
Phlorizin DMNARGO Investigative Phlorizin decreases the activity of UDP-glucuronosyltransferase 2B7. [15]
TCPOBOP DMKVF5Q Investigative TCPOBOP decreases the expression of UDP-glucuronosyltransferase 2B7. [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 34 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Impairment of bile acid metabolism by perfluorooctanoic acid (PFOA) and perfluorooctanesulfonic acid (PFOS) in human HepaRG hepatoma cells. Arch Toxicol. 2020 May;94(5):1673-1686. doi: 10.1007/s00204-020-02732-3. Epub 2020 Apr 6.
3 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Potential interactions among myricetin and dietary flavonols through the inhibition of human UDP-glucuronosyltransferase in vitro. Toxicol Lett. 2022 Apr 1;358:40-47. doi: 10.1016/j.toxlet.2022.01.007. Epub 2022 Jan 19.
6 A pilot study on the transcriptional response of androgen- and insulin-related genes in peripheral blood mononuclear cells induced by testosterone administration in hypogonadal men. J Biol Regul Homeost Agents. 2011 Apr-Jun;25(2):291-4.
7 Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
8 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
9 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
10 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
11 Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
12 Lithocholic acid decreases expression of UGT2B7 in Caco-2 cells: a potential role for a negative farnesoid X receptor response element. Drug Metab Dispos. 2005 Jul;33(7):937-46.
13 In vitro inhibition of human UDP-glucuronosyltransferase (UGT) 1A1 by osimertinib, and prediction of in vivo drug-drug interactions. Toxicol Lett. 2021 Sep 15;348:10-17. doi: 10.1016/j.toxlet.2021.05.004. Epub 2021 May 24.
14 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
15 Phloretin exhibits potential food-drug interactions by inhibiting human UDP-glucuronosyltransferases in vitro. Toxicol In Vitro. 2022 Oct;84:105447. doi: 10.1016/j.tiv.2022.105447. Epub 2022 Jul 19.
16 Resveratrol in human hepatoma HepG2 cells: metabolism and inducibility of detoxifying enzymes. Drug Metab Dispos. 2007 May;35(5):699-703.
17 Assessment of the inhibition potential of Licochalcone A against human UDP-glucuronosyltransferases. Food Chem Toxicol. 2016 Apr;90:112-22.
18 Benzo[a]pyrene and glycine N-methyltransferse interactions: gene expression profiles of the liver detoxification pathway. Toxicol Appl Pharmacol. 2006 Jul 15;214(2):126-35.
19 Metabolism and Toxicity of Emodin: Genome-Wide Association Studies Reveal Hepatocyte Nuclear Factor 4 Regulates UGT2B7 and Emodin Glucuronidation. Chem Res Toxicol. 2020 Jul 20;33(7):1798-1808. doi: 10.1021/acs.chemrestox.0c00047. Epub 2020 Jul 7.
20 Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
21 Pterostilbene supplements carry the risk of drug interaction via inhibition of UDP-glucuronosyltransferases (UGT) 1A9 enzymes. Toxicol Lett. 2020 Mar 1;320:46-51. doi: 10.1016/j.toxlet.2019.12.008. Epub 2019 Dec 5.
22 Induction of human UDP glucuronosyltransferases (UGT1A6, UGT1A9, and UGT2B7) by t-butylhydroquinone and 2,3,7,8-tetrachlorodibenzo-p-dioxin in Caco-2 cells. Drug Metab Dispos. 1999 May;27(5):569-73.
23 Mangifera indica Lextract and mangiferin modulate cytochrome P450 and UDP-glucuronosyltransferase enzymes in primary cultures of human hepatocytes. Phytother Res. 2013 May;27(5):745-52.
24 Histone methyltransferase DOT1L coordinates AR and MYC stability in prostate cancer. Nat Commun. 2020 Aug 19;11(1):4153. doi: 10.1038/s41467-020-18013-7.
25 Inhibition of human UGT2B7 gene expression in transgenic mice by the constitutive androstane receptor. Mol Pharmacol. 2011 Jun;79(6):1053-60.
26 Specificity and regioselectivity of the conjugation of estradiol, estrone, and their catecholestrogen and methoxyestrogen metabolites by human uridine diphospho-glucuronosyltransferases expressed in endometrium. J Clin Endocrinol Metab. 2004 Oct;89(10):5222-32. doi: 10.1210/jc.2004-0331.
27 Characterization of UDP-glucuronosyltransferases involved in glucuronidation of diethylstilbestrol in human liver and intestine. Chem Res Toxicol. 2012 Dec 17;25(12):2663-9. doi: 10.1021/tx300310k. Epub 2012 Nov 13.
28 Regioselective glucuronidation of denopamine: marked species differences and identification of human udp-glucuronosyltransferase isoform. Drug Metab Dispos. 2005 Mar;33(3):403-12.
29 Complementary deoxyribonucleic acid cloning and expression of a human liver uridine diphosphate-glucuronosyltransferase glucuronidating carboxylic acid-containing drugs. J Pharmacol Exp Ther. 1993 Jan;264(1):475-9.
30 Genetic polymorphism of UDP-glucuronosyltransferase 2B7 (UGT2B7) at amino acid 268: ethnic diversity of alleles and potential clinical significance. Pharmacogenetics. 2000 Nov;10(8):679-85. doi: 10.1097/00008571-200011000-00002.
31 Characterization of the UDP glucuronosyltransferase activity of human liver microsomes genotyped for the UGT1A1*28 polymorphism. Drug Metab Dispos. 2007 Dec;35(12):2270-80.
32 Glucuronidation of nonsteroidal anti-inflammatory drugs: identifying the enzymes responsible in human liver microsomes. Drug Metab Dispos. 2005 Jul;33(7):1027-35.
33 UGT-dependent regioselective glucuronidation of ursodeoxycholic acid and obeticholic acid and selective transport of the consequent acyl glucuronides by OATP1B1 and 1B3. Chem Biol Interact. 2019 Sep 1;310:108745. doi: 10.1016/j.cbi.2019.108745. Epub 2019 Jul 9.
34 Carboxylic acid drug-induced DNA nicking in HEK293 cells expressing human UDP-glucuronosyltransferases: role of acyl glucuronide metabolites and glycation pathways. Chem Res Toxicol. 2007 Oct;20(10):1520-7. doi: 10.1021/tx700188x. Epub 2007 Sep 20.
35 Involvement of human hepatic UGT1A1, UGT2B4, and UGT2B7 in the glucuronidation of carvedilol. Drug Metab Dispos. 2004 Feb;32(2):235-9. doi: 10.1124/dmd.32.2.235.
36 Carboxyl nonsteroidal anti-inflammatory drugs are efficiently glucuronidated by microsomes of the human gastrointestinal tract. Biochim Biophys Acta. 2004 Nov 18;1675(1-3):120-9. doi: 10.1016/j.bbagen.2004.08.013.
37 Aldosterone glucuronidation by human liver and kidney microsomes and recombinant UDP-glucuronosyltransferases: inhibition by NSAIDs. Br J Clin Pharmacol. 2009 Sep;68(3):402-12. doi: 10.1111/j.1365-2125.2009.03469.x.
38 Identification of human UDP-glucuronosyltransferase enzyme(s) responsible for the glucuronidation of ezetimibe (Zetia). Drug Metab Dispos. 2004 Mar;32(3):314-20.
39 The association between the C802T polymorphism of the UDP-glucuronosyltransferase 2B7 gene and effective topiramate dosage. Zh Nevrol Psikhiatr Im S S Korsakova. 2007;107(5):63-4.
40 Customised in vitro model to detect human metabolism-dependent idiosyncratic drug-induced liver injury. Arch Toxicol. 2018 Jan;92(1):383-399. doi: 10.1007/s00204-017-2036-4. Epub 2017 Jul 31.
41 Effect of genetic variations on ticagrelor plasma levels and clinical outcomes. Eur Heart J. 2015 Aug 1;36(29):1901-12.
42 (S)oxazepam glucuronidation is inhibited by ketoprofen and other substrates of UGT2B7. Pharmacogenetics. 1995 Feb;5(1):43-9. doi: 10.1097/00008571-199502000-00005.
43 Uridine diphosphate sugar-selective conjugation of an aldose reductase inhibitor (AS-3201) by UDP-glucuronosyltransferase 2B subfamily in human liver microsomes. Biochem Pharmacol. 2004 Apr 1;67(7):1269-78. doi: 10.1016/j.bcp.2003.11.010.
44 Metabolism of MK-0524, a prostaglandin D2 receptor 1 antagonist, in microsomes and hepatocytes from preclinical species and humans. Drug Metab Dispos. 2007 Feb;35(2):283-92. doi: 10.1124/dmd.106.011551. Epub 2006 Nov 28.
45 Human UDP-glucuronosyltransferase isoforms involved in bisphenol A glucuronidation. Chemosphere. 2008 Dec;74(1):33-6. doi: 10.1016/j.chemosphere.2008.09.053. Epub 2008 Nov 5.
46 Glucuronidation of oxidized fatty acids and prostaglandins B1 and E2 by human hepatic and recombinant UDP-glucuronosyltransferases. J Lipid Res. 2004 Sep;45(9):1694-703. doi: 10.1194/jlr.M400103-JLR200. Epub 2004 Jul 1.
47 Correlation between UDP-glucuronosyltransferase genotypes and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone glucuronidation phenotype in human liver microsomes. Cancer Res. 2004 Feb 1;64(3):1190-6. doi: 10.1158/0008-5472.can-03-3219.
48 Farnesol is glucuronidated in human liver, kidney and intestine in vitro, and is a novel substrate for UGT2B7 and UGT1A1. Biochem J. 2004 Dec 15;384(Pt 3):637-45. doi: 10.1042/BJ20040997.
49 Hepatic glucuronidation of 4-tert-octylphenol in humans: inter-individual variability and responsible UDP-glucuronosyltransferase isoforms. Arch Toxicol. 2017 Nov;91(11):3543-3550. doi: 10.1007/s00204-017-1982-1. Epub 2017 May 12.
50 Silybin inactivates cytochromes P450 3A4 and 2C9 and inhibits major hepatic glucuronosyltransferases. Drug Metab Dispos. 2004 Jun;32(6):587-94.
51 Effect of UGT2B7*2 and CYP2C8*4 polymorphisms on diclofenac metabolism. Toxicol Lett. 2018 Mar 1;284:70-78. doi: 10.1016/j.toxlet.2017.11.038. Epub 2017 Dec 2.