Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4RB40L)

DOT Name Keratin, type I cytoskeletal 20 (KRT20)
Synonyms Cytokeratin-20; CK-20; Keratin-20; K20; Protein IT
Gene Name KRT20
Related Disease
Follicular lymphoma ( )
Metastatic malignant neoplasm ( )
Small lymphocytic lymphoma ( )
Type-1 diabetes ( )
Acute myelogenous leukaemia ( )
Adenoma ( )
Adult lymphoma ( )
Autoimmune disease ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Burkitt lymphoma ( )
Colorectal neoplasm ( )
Gastric cancer ( )
Hepatitis C virus infection ( )
Hereditary diffuse gastric adenocarcinoma ( )
Idiopathic thrombocytopenic purpura ( )
leukaemia ( )
Lymphoma ( )
Membranous glomerulonephritis ( )
Multiple sclerosis ( )
Neuromyelitis optica ( )
Pediatric lymphoma ( )
Pemphigus ( )
Primary cutaneous peripheral T-cell lymphoma not otherwise specified ( )
Renal cell carcinoma ( )
Squamous cell carcinoma ( )
Transitional cell carcinoma ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Urothelial carcinoma ( )
Bladder transitional cell carcinoma ( )
Gastric neoplasm ( )
Hepatitis B virus infection ( )
Nervous system inflammation ( )
Tarsal-carpal coalition syndrome ( )
Cecal neoplasm ( )
Lymphoproliferative syndrome ( )
Stomach cancer ( )
Systemic lupus erythematosus ( )
T-cell lymphoma ( )
Waldenstrom macroglobulinemia ( )
Schizophrenia ( )
UniProt ID
K1C20_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00038
Sequence
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT
GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAY
YRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVF
DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN
EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL
QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIK
TRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV
EENI
Function Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine.
Tissue Specificity
Expressed predominantly in the intestinal epithelium. Expressed in luminal cells of colonic mucosa. Also expressed in the Merkel cells of keratinized oral mucosa; specifically at the tips of some rete ridges of the gingival mucosa, in the basal layer of the palatal mucosa and in the taste buds of lingual mucosa.
KEGG Pathway
Estrogen sig.ling pathway (hsa04915 )
Staphylococcus aureus infection (hsa05150 )
Reactome Pathway
Formation of the cornified envelope (R-HSA-6809371 )
Keratinization (R-HSA-6805567 )

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Follicular lymphoma DISVEUR6 Definitive Biomarker [1]
Metastatic malignant neoplasm DIS86UK6 Definitive Biomarker [2]
Small lymphocytic lymphoma DIS30POX Definitive Biomarker [3]
Type-1 diabetes DIS7HLUB Definitive Biomarker [4]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [5]
Adenoma DIS78ZEV Strong Biomarker [6]
Adult lymphoma DISK8IZR Strong Biomarker [7]
Autoimmune disease DISORMTM Strong Biomarker [8]
Bladder cancer DISUHNM0 Strong Biomarker [9]
Breast cancer DIS7DPX1 Strong Biomarker [10]
Breast carcinoma DIS2UE88 Strong Biomarker [10]
Burkitt lymphoma DIS9D5XU Strong Altered Expression [11]
Colorectal neoplasm DISR1UCN Strong Altered Expression [12]
Gastric cancer DISXGOUK Strong Biomarker [13]
Hepatitis C virus infection DISQ0M8R Strong Altered Expression [14]
Hereditary diffuse gastric adenocarcinoma DISUIBYS Strong Biomarker [15]
Idiopathic thrombocytopenic purpura DISFKGJU Strong Biomarker [16]
leukaemia DISS7D1V Strong Biomarker [17]
Lymphoma DISN6V4S Strong Biomarker [7]
Membranous glomerulonephritis DISFSUKQ Strong Biomarker [18]
Multiple sclerosis DISB2WZI Strong Biomarker [19]
Neuromyelitis optica DISBFGKL Strong Biomarker [7]
Pediatric lymphoma DIS51BK2 Strong Biomarker [7]
Pemphigus DISZAZ6M Strong Biomarker [20]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified DIS5OHQF Strong Biomarker [21]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [22]
Squamous cell carcinoma DISQVIFL Strong Biomarker [23]
Transitional cell carcinoma DISWVVDR Strong Biomarker [24]
Urinary bladder cancer DISDV4T7 Strong Biomarker [9]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [9]
Urothelial carcinoma DISRTNTN Strong Biomarker [24]
Bladder transitional cell carcinoma DISNL46A moderate Biomarker [25]
Gastric neoplasm DISOKN4Y moderate Biomarker [26]
Hepatitis B virus infection DISLQ2XY moderate Biomarker [27]
Nervous system inflammation DISB3X5A moderate Biomarker [28]
Tarsal-carpal coalition syndrome DISY90L2 moderate Altered Expression [29]
Cecal neoplasm DISV4OKA Limited Biomarker [30]
Lymphoproliferative syndrome DISMVL8O Limited Biomarker [31]
Stomach cancer DISKIJSX Limited Biomarker [13]
Systemic lupus erythematosus DISI1SZ7 Limited Biomarker [32]
T-cell lymphoma DISSXRTQ Limited Biomarker [21]
Waldenstrom macroglobulinemia DIS9O23I Limited Biomarker [33]
Schizophrenia DISSRV2N No Known Unknown [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 43 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Keratin, type I cytoskeletal 20 (KRT20). [35]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Keratin, type I cytoskeletal 20 (KRT20). [36]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Keratin, type I cytoskeletal 20 (KRT20). [37]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Keratin, type I cytoskeletal 20 (KRT20). [38]
Quercetin DM3NC4M Approved Quercetin increases the expression of Keratin, type I cytoskeletal 20 (KRT20). [39]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Keratin, type I cytoskeletal 20 (KRT20). [40]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Keratin, type I cytoskeletal 20 (KRT20). [41]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Keratin, type I cytoskeletal 20 (KRT20). [43]
D-glucose DMMG2TO Investigative D-glucose decreases the expression of Keratin, type I cytoskeletal 20 (KRT20). [44]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Keratin, type I cytoskeletal 20 (KRT20). [42]
------------------------------------------------------------------------------------

References

1 Safe administration of rituximab for follicular lymphoma after obinutuzumab infusion-related reaction.Int J Hematol. 2020 Apr;111(4):585-590. doi: 10.1007/s12185-019-02793-w. Epub 2019 Dec 17.
2 Intrabiliary metastases in colorectal cancer: a systematic review.J Hepatobiliary Pancreat Sci. 2019 Jul;26(7):270-280. doi: 10.1002/jhbp.635. Epub 2019 Jun 10.
3 Calcein release assay as a method for monitoring serum complement activity during monoclonal antibody therapy in patients with B-cell malignancies.J Immunol Methods. 2020 Jan;476:112675. doi: 10.1016/j.jim.2019.112675. Epub 2019 Oct 17.
4 Elevated T cell levels in peripheral blood predict poor clinical response following rituximab treatment in new-onset type 1 diabetes.Genes Immun. 2019 Apr;20(4):293-307. doi: 10.1038/s41435-018-0032-1. Epub 2018 Jun 21.
5 CD123-Engager T Cells as a Novel Immunotherapeutic for Acute Myeloid Leukemia.Mol Ther. 2016 Sep 29;24(9):1615-26. doi: 10.1038/mt.2016.116. Epub 2016 Jun 6.
6 Inflammatory infiltrates in parathyroid tumors.Eur J Endocrinol. 2017 Dec;177(6):445-453. doi: 10.1530/EJE-17-0277. Epub 2017 Aug 30.
7 Two cases of aquaporin-4 positive neuromyelitis optica associated with T-cell lymphoma.J Neuroimmunol. 2020 Jan 15;338:577092. doi: 10.1016/j.jneuroim.2019.577092. Epub 2019 Oct 30.
8 High-throughput compound screen reveals mTOR inhibitors as potential therapeutics to reduce (auto)antibody production by human plasma cells.Eur J Immunol. 2020 Jan;50(1):73-85. doi: 10.1002/eji.201948241. Epub 2019 Nov 14.
9 Diagnostic accuracy of urine cytokeratin 20 for bladder cancer: A meta-analysis.Asia Pac J Clin Oncol. 2019 Apr;15(2):e11-e19. doi: 10.1111/ajco.13024. Epub 2018 Jun 22.
10 Adult-onset Still's disease-like manifestation accompanied by the cancer recurrence after long-term resting state.Mod Rheumatol. 2019 Jul;29(4):704-707. doi: 10.1080/14397595.2016.1259547. Epub 2016 Dec 9.
11 Anti-human SIRP antibody is a new tool for cancer immunotherapy.Cancer Sci. 2018 May;109(5):1300-1308. doi: 10.1111/cas.13548. Epub 2018 Apr 15.
12 Overexpression of CK20, MAP3K8 and EIF5A correlates with poor prognosis in early-onset colorectal cancer patients.J Cancer Res Clin Oncol. 2013 Apr;139(4):691-702. doi: 10.1007/s00432-013-1372-x. Epub 2013 Jan 16.
13 Aberrant Cytokeratin 20 mRNA Expression in Peripheral Blood and Lymph Nodes Indicates Micrometastasis and Poor Prognosis in Patients With Gastric Carcinoma.Technol Cancer Res Treat. 2019 Jan 1;18:1533033819832856. doi: 10.1177/1533033819832856.
14 Contradictory intrahepatic immune responses activated in high-load hepatitis C virus livers compared with low-load livers.Arch Virol. 2018 Apr;163(4):855-865. doi: 10.1007/s00705-017-3675-8. Epub 2017 Dec 16.
15 Diverse proteomic alterations in gastric adenocarcinoma.Proteomics. 2004 Oct;4(10):3276-87. doi: 10.1002/pmic.200300916.
16 Anterior ST-elevation myocardial infarction induced by rituximab infusion: A case report and review of the literature.J Clin Pharm Ther. 2017 Jun;42(3):356-362. doi: 10.1111/jcpt.12522.
17 17p deletion strongly influences rituximab elimination in chronic lymphocytic leukemia.J Immunother Cancer. 2019 Jan 29;7(1):22. doi: 10.1186/s40425-019-0509-0.
18 Accelerating the Depletion of Circulating Anti-Phospholipase A2 Receptor Antibodies in Patients with Severe Membranous Nephropathy: Preliminary Findings with Double Filtration Plasmapheresis and Ofatumumab.Nephron. 2020;144(1):30-35. doi: 10.1159/000501858. Epub 2019 Jul 23.
19 Failed B cell survival factor trials support the importance of memory B cells in multiple sclerosis.Eur J Neurol. 2020 Feb;27(2):221-228. doi: 10.1111/ene.14105. Epub 2019 Nov 6.
20 Diagnosis and management of pemphigus: Recommendations of an international panel of experts.J Am Acad Dermatol. 2020 Mar;82(3):575-585.e1. doi: 10.1016/j.jaad.2018.02.021. Epub 2018 Feb 10.
21 CD20-positive primary nasal peripheral T-cell lymphoma: An analysis of one case and review of the literature.Cytometry B Clin Cytom. 2020 Jul;98(4):348-354. doi: 10.1002/cyto.b.21852. Epub 2019 Nov 4.
22 Re-evaluation of 33 'unclassified' eosinophilic renal cell carcinomas in young patients.Histopathology. 2018 Mar;72(4):588-600. doi: 10.1111/his.13395. Epub 2017 Dec 4.
23 Evidence of proliferative activity in human Merkel cells: implications in the histogenesis of Merkel cell carcinoma.Arch Dermatol Res. 2019 Jan;311(1):37-43. doi: 10.1007/s00403-018-1877-x. Epub 2018 Nov 20.
24 Transcriptional Analysis of Immunohistochemically Defined Subgroups of Non-Muscle-Invasive Papillary High-Grade Upper Tract Urothelial Carcinoma.Int J Mol Sci. 2019 Jan 29;20(3):570. doi: 10.3390/ijms20030570.
25 Immunohistochemistry of cytokeratin (CK) 5/6, CD44 and CK20 as prognostic biomarkers of non-muscle-invasive papillary upper tract urothelial carcinoma.Histopathology. 2019 Feb;74(3):483-493. doi: 10.1111/his.13763. Epub 2018 Dec 2.
26 Detection of circulating gastric cancer cells in peripheral blood using real time quantitative RT-PCR.Hepatogastroenterology. 2008 May-Jun;55(84):1131-5.
27 Risk of HBV reactivation in patients with B-cell lymphomas receiving obinutuzumab or rituximab immunochemotherapy.Blood. 2019 Jan 10;133(2):137-146. doi: 10.1182/blood-2018-04-848044. Epub 2018 Oct 19.
28 Efficient Distribution of a Novel Zirconium-89 Labeled Anti-cd20 Antibody Following Subcutaneous and Intravenous Administration in Control and Experimental Autoimmune Encephalomyelitis-Variant Mice.Front Immunol. 2019 Oct 18;10:2437. doi: 10.3389/fimmu.2019.02437. eCollection 2019.
29 Urinary cytokeratin 20 mRNA expression has the potential to predict recurrence in superficial transitional cell carcinoma of the bladder.Cancer Lett. 2007 Jan 8;245(1-2):121-6. doi: 10.1016/j.canlet.2005.12.038. Epub 2006 Feb 13.
30 o-Nitrotoluene-induced large intestinal tumors in B6C3F1 mice model human colon cancer in their molecular pathogenesis.Carcinogenesis. 2004 Apr;25(4):605-12. doi: 10.1093/carcin/bgh044. Epub 2003 Dec 19.
31 Improving CD20 antibody therapy: obinutuzumab in lymphoproliferative disorders.Leuk Lymphoma. 2019 Mar;60(3):573-582. doi: 10.1080/10428194.2018.1498490. Epub 2019 Jan 22.
32 Sustained B cell depletion by CD19-targeted CAR T cells is a highly effective treatment for murine lupus.Sci Transl Med. 2019 Mar 6;11(482):eaav1648. doi: 10.1126/scitranslmed.aav1648.
33 How I treat Waldenstrm macroglobulinemia.Blood. 2019 Dec 5;134(23):2022-2035. doi: 10.1182/blood.2019000725.
34 De novo mutations in schizophrenia implicate synaptic networks. Nature. 2014 Feb 13;506(7487):179-84. doi: 10.1038/nature12929. Epub 2014 Jan 22.
35 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
36 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
37 Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
38 Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
39 Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
40 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
41 Peroxisome proliferator-activated receptor gamma as a molecular target of resveratrol-induced modulation of polyamine metabolism. Cancer Res. 2006 Jul 15;66(14):7348-54. doi: 10.1158/0008-5472.CAN-05-2777.
42 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
43 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
44 The role of the p38 MAPK signaling pathway in high glucose-induced epithelial-mesenchymal transition of cultured human renal tubular epithelial cells. PLoS One. 2011;6(7):e22806. doi: 10.1371/journal.pone.0022806. Epub 2011 Jul 29.