Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6RMDCE)

• DOT Name: cAMP-dependent protein kinase catalytic subunit beta (PRKACB)
• Synonyms: PKA C-beta; EC 2.7.11.11
• Gene Name: PRKACB
• Related Disease:
  Anencephaly
  Acromegaly
  Acute myelogenous leukaemia
  Adenoma
  Adrenal adenoma
  Adrenal gland neoplasm
  Alzheimer disease
  Breast carcinoma
  Cardioacrofacial dysplasia 2
  Carney complex
  Cholangiocarcinoma
  Colorectal carcinoma
  Congenital adrenal hyperplasia
  Gastric cancer
  Intrahepatic cholangiocarcinoma
  Matthew-Wood syndrome
  Neoplasm
  Neural tube defect
  Osteoarthritis
  Prostate cancer
  Prostate neoplasm
  Parkinson disease
  Biliary tract cancer
  Biliary tract neoplasm
• UniProt ID: KAPCB_HUMAN
• EC Number: 2.7.11.11
• Pfam ID: PF00069
• Sequence:
  MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVML
  VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
  MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
  IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
  ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
  TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
• Function: Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA. Acts as a negative regulator of mTORC1 by mediating phosphorylation of RPTOR.
• Tissue Specificity: Isoform 1 is most abundant in the brain, with low level expression in kidney. Isoform 2 is predominantly expressed in thymus, spleen and kidney. Isoform 3 and isoform 4 are only expressed in the brain.
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  MAPK sig.ling pathway (hsa04010)
  Ras sig.ling pathway (hsa04014)
  Calcium sig.ling pathway (hsa04020)
  cAMP sig.ling pathway (hsa04024)
  Chemokine sig.ling pathway (hsa04062)
  Oocyte meiosis (hsa04114)
  Autophagy - animal (hsa04140)
  Longevity regulating pathway (hsa04211)
  Longevity regulating pathway - multiple species (hsa04213)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Vascular smooth muscle contraction (hsa04270)
  Wnt sig.ling pathway (hsa04310)
  Hedgehog sig.ling pathway (hsa04340)
  Apelin sig.ling pathway (hsa04371)
  Tight junction (hsa04530)
  Gap junction (hsa04540)
  Platelet activation (hsa04611)
  Circadian entrainment (hsa04713)
  Thermogenesis (hsa04714)
  Long-term potentiation (hsa04720)
  Retrograde endocan.binoid sig.ling (hsa04723)
  Glutamatergic sy.pse (hsa04724)
  Cholinergic sy.pse (hsa04725)
  Serotonergic sy.pse (hsa04726)
  GABAergic sy.pse (hsa04727)
  Dopaminergic sy.pse (hsa04728)
  Olfactory transduction (hsa04740)
  Taste transduction (hsa04742)
  Inflammatory mediator regulation of TRP channels (hsa04750)
  Insulin sig.ling pathway (hsa04910)
  Insulin secretion (hsa04911)
  GnRH sig.ling pathway (hsa04912)
  Ovarian steroidogenesis (hsa04913)
  Progesterone-mediated oocyte maturation (hsa04914)
  Estrogen sig.ling pathway (hsa04915)
  Melanogenesis (hsa04916)
  Thyroid hormone synthesis (hsa04918)
  Thyroid hormone sig.ling pathway (hsa04919)
  Oxytocin sig.ling pathway (hsa04921)
  Glucagon sig.ling pathway (hsa04922)
  Regulation of lipolysis in adipocytes (hsa04923)
  Renin secretion (hsa04924)
  Aldosterone synthesis and secretion (hsa04925)
  Relaxin sig.ling pathway (hsa04926)
  Cortisol synthesis and secretion (hsa04927)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  Cushing syndrome (hsa04934)
  Growth hormone synthesis, secretion and action (hsa04935)
  Endocrine and other factor-regulated calcium reabsorption (hsa04961)
  Vasopressin-regulated water reabsorption (hsa04962)
  Salivary secretion (hsa04970)
  Gastric acid secretion (hsa04971)
  Bile secretion (hsa04976)
  Parkinson disease (hsa05012)
  Prion disease (hsa05020)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Morphine addiction (hsa05032)
  Alcoholism (hsa05034)
  Vibrio cholerae infection (hsa05110)
  Amoebiasis (hsa05146)
  Human cytomegalovirus infection (hsa05163)
  Human papillomavirus infection (hsa05165)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Pathways in cancer (hsa05200)
  Viral carcinogenesis (hsa05203)
  Proteoglycans in cancer (hsa05205)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Dilated cardiomyopathy (hsa05414)
• Reactome Pathway:
  PKA-mediated phosphorylation of key metabolic factors (R-HSA-163358)
  Triglyceride catabolism (R-HSA-163560)
  PKA activation (R-HSA-163615)
  PKA activation in glucagon signalling (R-HSA-164378)
  DARPP-32 events (R-HSA-180024)
  Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676)
  Rap1 signalling (R-HSA-392517)
  Regulation of insulin secretion (R-HSA-422356)
  Vasopressin regulates renal water homeostasis via Aquaporins (R-HSA-432040)
  VEGFA-VEGFR2 Pathway (R-HSA-4420097)
  CREB1 phosphorylation through the activation of Adenylate Cyclase (R-HSA-442720)
  Degradation of GLI1 by the proteasome (R-HSA-5610780)
  Degradation of GLI2 by the proteasome (R-HSA-5610783)
  GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785)
  Hedgehog 'off' state (R-HSA-5610787)
  CD209 (DC-SIGN) signaling (R-HSA-5621575)
  MAPK6/MAPK4 signaling (R-HSA-5687128)
  RET signaling (R-HSA-8853659)
  HDL assembly (R-HSA-8963896)
  ROBO receptors bind AKAP5 (R-HSA-9010642)
  GPER1 signaling (R-HSA-9634597)
  Regulation of glycolysis by fructose 2,6-bisphosphate metabolism (R-HSA-9634600)
  ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821)
  FCGR3A-mediated IL10 synthesis (R-HSA-9664323)
  Factors involved in megakaryocyte development and platelet production (R-HSA-983231)
  PKA-mediated phosphorylation of CREB (R-HSA-111931)

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anencephaly	DISIYW6T	Definitive	Genetic Variation	[1]
Acromegaly	DISCC73U	Strong	Genetic Variation	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[3]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[4]
Adrenal adenoma	DISC2UN8	Strong	Biomarker	[4]
Adrenal gland neoplasm	DISFK7RF	Strong	Genetic Variation	[4]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[5]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[6]
Cardioacrofacial dysplasia 2	DIS0FHJ0	Strong	Autosomal dominant	[7]
Carney complex	DISVL3IP	Strong	Genetic Variation	[2]
Cholangiocarcinoma	DIS71F6X	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[9]
Congenital adrenal hyperplasia	DISG873W	Strong	Genetic Variation	[10]
Gastric cancer	DISXGOUK	Strong	Biomarker	[11]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Genetic Variation	[12]
Matthew-Wood syndrome	DISA7HR7	Strong	Genetic Variation	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[14]
Neural tube defect	DIS5J95E	Strong	Genetic Variation	[1]
Osteoarthritis	DIS05URM	Strong	Biomarker	[15]
Prostate cancer	DISF190Y	Strong	Biomarker	[16]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[16]
Parkinson disease	DISQVHKL	Disputed	Biomarker	[17]
Biliary tract cancer	DISBNYQL	Limited	Biomarker	[18]
Biliary tract neoplasm	DISLWLHH	Limited	Biomarker	[18]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Capecitabine	DMTS85L	Approved	cAMP-dependent protein kinase catalytic subunit beta (PRKACB) decreases the response to substance of Capecitabine.	[45]
[3H]cAMP	DMZRQU7	Investigative	cAMP-dependent protein kinase catalytic subunit beta (PRKACB) affects the response to substance of [3H]cAMP.	[4]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[19]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[20]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen affects the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[22]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[24]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[25]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[26]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[27]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[28]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[29]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[27]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[30]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[31]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[32]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[32]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[26]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[33]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[34]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[37]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[39]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[40]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[41]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone affects the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[16]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[38]
Octanal	DMTN0OK	Investigative	Octanal increases the methylation of cAMP-dependent protein kinase catalytic subunit beta (PRKACB).	[44]

References

• [1] Association between PKA gene polymorphism and NTDs in high risk Chinese population in Shanxi.Int J Clin Exp Pathol. 2013 Nov 15;6(12):2968-74. eCollection 2013.
• [2] Sequence analysis of the catalytic subunit of PKA in somatotroph adenomas.Eur J Endocrinol. 2014 Dec;171(6):705-10. doi: 10.1530/EJE-14-0545. Epub 2014 Sep 15.
• [3] Role of Circular RNA DLEU2 in Human Acute Myeloid Leukemia.Mol Cell Biol. 2018 Sep 28;38(20):e00259-18. doi: 10.1128/MCB.00259-18. Print 2018 Oct 15.
• [4] Activating PRKACB somatic mutation in cortisol-producing adenomas. JCI Insight. 2018 Apr 19;3(8):e98296. doi: 10.1172/jci.insight.98296. eCollection 2018 Apr 19.
• [5] Genetic variation in the tau kinases pathway may modify the risk and age at onset of Alzheimer's disease.J Alzheimers Dis. 2011;27(2):291-7. doi: 10.3233/JAD-2011-110794.
• [6] Genome-wide association study identifies a common variant in RAD51B associated with male breast cancer risk.Nat Genet. 2012 Nov;44(11):1182-4. doi: 10.1038/ng.2417. Epub 2012 Sep 23.
• [7] Germline and Mosaic Variants in PRKACA and PRKACB Cause a Multiple Congenital Malformation Syndrome. Am J Hum Genet. 2020 Nov 5;107(5):977-988. doi: 10.1016/j.ajhg.2020.09.005. Epub 2020 Oct 14.
• [8] Targeting cholangiocarcinoma.Biochim Biophys Acta Mol Basis Dis. 2018 Apr;1864(4 Pt B):1454-1460. doi: 10.1016/j.bbadis.2017.08.027. Epub 2017 Aug 24.
• [9] Alteration of microRNA-4474/4717 expression and CREB-binding protein in human colorectal cancer tissues infected with Fusobacterium nucleatum.PLoS One. 2019 Apr 5;14(4):e0215088. doi: 10.1371/journal.pone.0215088. eCollection 2019.
• [10] Carney complex: an update.Eur J Endocrinol. 2015 Oct;173(4):M85-97. doi: 10.1530/EJE-15-0209. Epub 2015 Jun 30.
• [11] Integrated analysis of whole genome exon array and array-comparative genomic hybridization in gastric and colorectal cancer cells.Cancer Sci. 2012 Feb;103(2):221-7. doi: 10.1111/j.1349-7006.2011.02132.x. Epub 2011 Nov 28.
• [12] FGFR2 genomic aberrations: Achilles heel in the management of advanced cholangiocarcinoma.Cancer Treat Rev. 2019 Aug;78:1-7. doi: 10.1016/j.ctrv.2019.06.003. Epub 2019 Jun 22.
• [13] Recurrent Rearrangements in PRKACA and PRKACB in Intraductal Oncocytic Papillary Neoplasms of the Pancreas andBile Duct.Gastroenterology. 2020 Feb;158(3):573-582.e2. doi: 10.1053/j.gastro.2019.10.028. Epub 2019 Oct 31.
• [14] Prediction of novel target genes and pathways involved in irinotecan-resistant colorectal cancer.PLoS One. 2017 Jul 27;12(7):e0180616. doi: 10.1371/journal.pone.0180616. eCollection 2017.
• [15] Upregulation of miR-23b enhances the autologous therapeutic potential for degenerative arthritis by targeting PRKACB in synovial fluid-derived mesenchymal stem cells from patients.Mol Cells. 2014 Jun;37(6):449-56. doi: 10.14348/molcells.2014.0023. Epub 2014 Jun 11.
• [16] Androgen dependent regulation of protein kinase A subunits in prostate cancer cells. Cell Signal. 2007 Feb;19(2):401-9. doi: 10.1016/j.cellsig.2006.07.011. Epub 2006 Jul 25.
• [17] Identification of key genes and pathways in Parkinson's disease through integrated analysis.Mol Med Rep. 2017 Oct;16(4):3769-3776. doi: 10.3892/mmr.2017.7112. Epub 2017 Jul 31.
• [18] Genomic spectra of biliary tract cancer.Nat Genet. 2015 Sep;47(9):1003-10. doi: 10.1038/ng.3375. Epub 2015 Aug 10.
• [19] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [20] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [21] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [22] Identification of potential biomarkers of hepatitis B-induced acute liver failure using hepatic cells derived from human skin precursors. Toxicol In Vitro. 2015 Sep;29(6):1231-9. doi: 10.1016/j.tiv.2014.10.012. Epub 2014 Oct 24.
• [23] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [24] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [25] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [26] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [27] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [28] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [29] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [30] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [31] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [32] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [33] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [34] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [35] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [36] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [37] Epigenetic changes and disturbed neural development in a human embryonic stem cell-based model relating to the fetal valproate syndrome. Hum Mol Genet. 2012 Sep 15;21(18):4104-14. doi: 10.1093/hmg/dds239. Epub 2012 Jun 20.
• [38] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [39] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [40] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [41] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [42] Androgen dependent regulation of protein kinase A subunits in prostate cancer cells. Cell Signal. 2007 Feb;19(2):401-9. doi: 10.1016/j.cellsig.2006.07.011. Epub 2006 Jul 25.
• [43] Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
• [44] DNA Methylome Analysis of Saturated Aliphatic Aldehydes in Pulmonary Toxicity. Sci Rep. 2018 Jul 12;8(1):10497. doi: 10.1038/s41598-018-28813-z.
• [45] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.
• [46] Activating PRKACB somatic mutation in cortisol-producing adenomas. JCI Insight. 2018 Apr 19;3(8):e98296. doi: 10.1172/jci.insight.98296. eCollection 2018 Apr 19.