Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT71LJ8T)

• DOT Name: Galectin-8 (LGALS8)
• Synonyms: Gal-8; Po66 carbohydrate-binding protein; Po66-CBP; Prostate carcinoma tumor antigen 1; PCTA-1
• Gene Name: LGALS8
• Related Disease:
  Familial prostate carcinoma
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Carcinoma
  Colon cancer
  Epithelial ovarian cancer
  Lung cancer
  Lung carcinoma
  Lung squamous cell carcinoma
  Multiple sclerosis
  Neoplasm
  Nervous system inflammation
  Ovarian cancer
  Plasma cell myeloma
  Postmenopausal osteoporosis
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Adult glioblastoma
  Advanced cancer
  Glioblastoma multiforme
  Osteoarthritis
  Bernard-Soulier syndrome
  Clear cell renal carcinoma
  Glanzmann thrombasthenia
  Myasthenia gravis
  Triple negative breast cancer
• UniProt ID: LEG8_HUMAN
• PDB ID: 2YRO ; 2YV8 ; 2YXS ; 3AP4 ; 3AP5 ; 3AP6 ; 3AP7 ; 3AP9 ; 3APB ; 3OJB ; 3VKL ; 3VKM ; 3VKN ; 3VKO ; 4BMB ; 4BME ; 4FQZ ; 4GXL ; 4HAN ; 5GZC ; 5GZD ; 5GZE ; 5GZF ; 5GZG ; 5T7I ; 5T7S ; 5T7T ; 5T7U ; 5VWG ; 6W4Z ; 6Z6Y ; 7AEN ; 7ALS ; 7P1M ; 8HL9
• Pfam ID: PF00337
• Sequence:
  MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRA
  DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG
  KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT
  PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV
  RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSI
  DTLEINGDIHLLEVRSW
• Function: Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
• Tissue Specificity: Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Familial prostate carcinoma	DISL9KNO	Definitive	Genetic Variation	[1]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Carcinoma	DISH9F1N	Strong	Altered Expression	[4]
Colon cancer	DISVC52G	Strong	Altered Expression	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[6]
Lung cancer	DISCM4YA	Strong	Biomarker	[7]
Lung carcinoma	DISTR26C	Strong	Biomarker	[7]
Lung squamous cell carcinoma	DISXPIBD	Strong	Altered Expression	[5]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[8]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[6]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[10]
Postmenopausal osteoporosis	DISS0RQZ	Strong	Biomarker	[11]
Prostate cancer	DISF190Y	Strong	Biomarker	[12]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[12]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[5]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[14]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[15]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[16]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[15]
Osteoarthritis	DIS05URM	moderate	Biomarker	[17]
Bernard-Soulier syndrome	DISLD1FU	Limited	Biomarker	[18]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[16]
Glanzmann thrombasthenia	DISFGGTG	Limited	Biomarker	[18]
Myasthenia gravis	DISELRCI	Limited	Genetic Variation	[13]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[3]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Galectin-8 (LGALS8).	[19]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Galectin-8 (LGALS8).	[20]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Galectin-8 (LGALS8).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Galectin-8 (LGALS8).	[22]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Galectin-8 (LGALS8).	[23]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Galectin-8 (LGALS8).	[24]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Galectin-8 (LGALS8).	[25]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Galectin-8 (LGALS8).	[26]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Galectin-8 (LGALS8).	[27]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Galectin-8 (LGALS8).	[28]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Galectin-8 (LGALS8).	[29]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Galectin-8 (LGALS8).	[30]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Galectin-8 (LGALS8).	[31]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Galectin-8 (LGALS8).	[32]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Galectin-8 (LGALS8).	[33]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Galectin-8 (LGALS8).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Galectin-8 (LGALS8).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Galectin-8 (LGALS8).	[37]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Galectin-8 (LGALS8).	[25]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Galectin-8 (LGALS8).	[38]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Galectin-8 (LGALS8).	[35]

References

• [1] A candidate gene approach within the susceptibility region PCaP on 1q42.2-43 excludes deleterious mutations of the PCTA-1 gene to be responsible for hereditary prostate cancer.Eur Urol. 2002 Sep;42(3):301-7. doi: 10.1016/s0302-2838(02)00280-4.
• [2] The Impact of Natural Selection on the Evolution and Function of Placentally Expressed Galectins.Genome Biol Evol. 2019 Sep 1;11(9):2574-2592. doi: 10.1093/gbe/evz183.
• [3] Dual knockdown of Galectin-8 and its glycosylated ligand, the activated leukocyte cell adhesion molecule (ALCAM/CD166), synergistically delays in vivo breast cancer growth.Biochim Biophys Acta Mol Cell Res. 2019 Aug;1866(8):1338-1352. doi: 10.1016/j.bbamcr.2019.03.010. Epub 2019 Mar 21.
• [4] Galectin-8 induces endothelial hyperpermeability through the eNOS pathway involving S-nitrosylation-mediated adherens junction disassembly.Carcinogenesis. 2019 Apr 29;40(2):313-323. doi: 10.1093/carcin/bgz002.
• [5] Human galectin-8 isoforms and cancer.Glycoconj J. 2002;19(7-9):557-63. doi: 10.1023/B:GLYC.0000014086.38343.98.
• [6] Tissue and plasma levels of galectins in patients with high grade serous ovarian carcinoma as new predictive biomarkers.Sci Rep. 2017 Oct 16;7(1):13244. doi: 10.1038/s41598-017-13802-5.
• [7] Two messenger RNAs and five isoforms for Po66-CBP, a galectin-8 homolog in a human lung carcinoma cell line.Gene. 2001 Aug 22;274(1-2):253-62. doi: 10.1016/s0378-1119(01)00598-4.
• [8] Galectin-8 as an immunosuppressor in experimental autoimmune encephalomyelitis and a target of human early prognostic antibodies in multiple sclerosis.PLoS One. 2017 Jun 26;12(6):e0177472. doi: 10.1371/journal.pone.0177472. eCollection 2017.
• [9] Gal8 Visualization of Endosome Disruption Predicts Carrier-Mediated Biologic Drug Intracellular Bioavailability.ACS Nano. 2019 Feb 26;13(2):1136-1152. doi: 10.1021/acsnano.8b05482. Epub 2019 Jan 18.
• [10] Role of Galectins in Multiple Myeloma.Int J Mol Sci. 2017 Dec 17;18(12):2740. doi: 10.3390/ijms18122740.
• [11] Ablation of the mammalian lectin galectin-8 induces bone defects in mice.FASEB J. 2018 May;32(5):2366-2380. doi: 10.1096/fj.201700716R. Epub 2017 Dec 19.
• [12] Stable and high expression of Galectin-8 tightly controls metastatic progression of prostate cancer.Oncotarget. 2017 Jul 4;8(27):44654-44668. doi: 10.18632/oncotarget.17963.
• [13] Non-synonymous single nucleotide polymorphisms in genes for immunoregulatory galectins: association of galectin-8 (F19Y) occurrence with autoimmune diseases in a Caucasian population.Biochim Biophys Acta. 2012 Oct;1820(10):1512-8. doi: 10.1016/j.bbagen.2012.05.015. Epub 2012 Jun 7.
• [14] Autoantibodies against galectin-8: their specificity, association with lymphopenia in systemic lupus erythematosus and detection in rheumatoid arthritis and acute inflammation.Lupus. 2009 May;18(6):539-46. doi: 10.1177/0961203308099973.
• [15] Galectin-8 promotes migration and proliferation and prevents apoptosis in U87 glioblastoma cells.Biol Res. 2016 Jul 27;49(1):33. doi: 10.1186/s40659-016-0091-6.
• [16] Galectin-8 predicts postoperative recurrence of patients with localized T1 clear cell renal cell carcinoma.Urol Oncol. 2015 Mar;33(3):112.e1-8. doi: 10.1016/j.urolonc.2014.11.001. Epub 2014 Nov 5.
• [17] Galectin-8 induces functional disease markers in human osteoarthritis and cooperates with galectins-1 and -3.Cell Mol Life Sci. 2018 Nov;75(22):4187-4205. doi: 10.1007/s00018-018-2856-2. Epub 2018 Jun 22.
• [18] Human platelets express and are activated by galectin-8.Biochem J. 2010 Dec 15;432(3):535-47. doi: 10.1042/BJ20100538.
• [19] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [20] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [21] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [22] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [23] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [24] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [25] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [26] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [27] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [28] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [29] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [30] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [31] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [32] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [33] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [34] Toxicoproteomics reveals an effect of clozapine on autophagy in human liver spheroids. Toxicol Mech Methods. 2023 Jun;33(5):401-410. doi: 10.1080/15376516.2022.2156005. Epub 2022 Dec 19.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [37] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [38] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.