Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTA1L0P8)

• DOT Name: Tropomyosin beta chain (TPM2)
• Synonyms: Beta-tropomyosin; Tropomyosin-2
• Gene Name: TPM2
• Related Disease:
  Breast cancer
  Breast carcinoma
  Carcinoma of esophagus
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Neoplasm of esophagus
  Spondylocarpotarsal synostosis syndrome
  Squamous cell carcinoma
  TPM2-related myopathy
  Advanced cancer
  Arteriosclerosis
  Arthrogryposis
  Arthrogryposis, distal, type 1A
  Atherosclerosis
  Autosomal recessive multiple pterygium syndrome
  Cataract
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congenital myopathy
  Congenital myopathy 23
  Congenital vertical talus
  Distal arthrogryposis
  Freeman-Sheldon syndrome
  Hypertrophic cardiomyopathy
  Myofibrillar myopathy
  Neoplasm
  Pancreas disorder
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate carcinoma
  Psoriasis
  Respiratory failure
  Cap myopathy
  Childhood-onset nemaline myopathy
  Congenital fiber-type disproportion myopathy
  Digitotalar dysmorphism
  Sheldon-hall syndrome
  Typical nemaline myopathy
  Bladder cancer
  Clubfoot
  Cognitive impairment
  Congenital myopathy 7A, myosin storage, autosomal dominant
  Lethal multiple pterygium syndrome
  Urinary bladder cancer
  Urinary bladder neoplasm
  Zebra body myopathy
• UniProt ID: TPM2_HUMAN
• Pfam ID: PF00261
• Sequence:
  MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
  SESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
  DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
  ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
  FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
• Function: Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. The non-muscle isoform may have a role in agonist-mediated receptor internalization.
• Tissue Specificity: Present in primary breast cancer tissue, absent from normal breast tissue.
• KEGG Pathway:
  Cardiac muscle contraction (hsa04260)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Motor proteins (hsa04814)
  Cytoskeleton in muscle cells (hsa04820)
  Hypertrophic cardiomyopathy (hsa05410)
  Dilated cardiomyopathy (hsa05414)
• Reactome Pathway:
  Smooth Muscle Contraction (R-HSA-445355)
  Striated Muscle Contraction (R-HSA-390522)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Definitive	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Definitive	Altered Expression	[1]
Carcinoma of esophagus	DISS6G4D	Definitive	Altered Expression	[2]
Esophageal cancer	DISGB2VN	Definitive	Altered Expression	[2]
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Biomarker	[3]
Neoplasm of esophagus	DISOLKAQ	Definitive	Altered Expression	[2]
Spondylocarpotarsal synostosis syndrome	DISF9VP3	Definitive	Genetic Variation	[4]
Squamous cell carcinoma	DISQVIFL	Definitive	Altered Expression	[2]
TPM2-related myopathy	DIS7PCBA	Definitive	Autosomal dominant	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Arthrogryposis	DISC81CM	Strong	Genetic Variation	[7]
Arthrogryposis, distal, type 1A	DISD8IKM	Strong	Autosomal dominant	[8]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Autosomal recessive multiple pterygium syndrome	DISVK1D4	Strong	Biomarker	[9]
Cataract	DISUD7SL	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Posttranslational Modification	[11]
Colon carcinoma	DISJYKUO	Strong	Posttranslational Modification	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[11]
Congenital myopathy	DISLSK9G	Strong	Genetic Variation	[7]
Congenital myopathy 23	DISYBLP9	Strong	Autosomal dominant	[8]
Congenital vertical talus	DISZF3HD	Strong	Biomarker	[12]
Distal arthrogryposis	DIS3QIEL	Strong	Genetic Variation	[13]
Freeman-Sheldon syndrome	DIS7V9PS	Strong	Biomarker	[14]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[15]
Myofibrillar myopathy	DISF24LW	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Pancreas disorder	DISDH7NI	Strong	Biomarker	[17]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[10]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[18]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[18]
Psoriasis	DIS59VMN	Strong	Altered Expression	[19]
Respiratory failure	DISVMYJO	Strong	Genetic Variation	[20]
Cap myopathy	DIS4S4WQ	Supportive	Autosomal dominant	[21]
Childhood-onset nemaline myopathy	DIST7MSL	Supportive	Autosomal dominant	[22]
Congenital fiber-type disproportion myopathy	DISU9T2M	Supportive	Autosomal dominant	[23]
Digitotalar dysmorphism	DISOW5Q1	Supportive	Autosomal dominant	[24]
Sheldon-hall syndrome	DISOCVMC	Supportive	Autosomal dominant	[24]
Typical nemaline myopathy	DISY1645	Supportive	Autosomal dominant	[25]
Bladder cancer	DISUHNM0	Limited	Altered Expression	[26]
Clubfoot	DISLXT4S	Limited	Genetic Variation	[27]
Cognitive impairment	DISH2ERD	Limited	Biomarker	[28]
Congenital myopathy 7A, myosin storage, autosomal dominant	DISUV37B	Limited	Genetic Variation	[29]
Lethal multiple pterygium syndrome	DIS668BA	Limited	Genetic Variation	[30]
Urinary bladder cancer	DISDV4T7	Limited	Altered Expression	[26]
Urinary bladder neoplasm	DIS7HACE	Limited	Altered Expression	[26]
Zebra body myopathy	DISMCSNK	Limited	Biomarker	[29]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Tropomyosin beta chain (TPM2).	[31]
Arsenic	DMTL2Y1	Approved	Arsenic increases the ubiquitination of Tropomyosin beta chain (TPM2).	[39]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Tropomyosin beta chain (TPM2).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Tropomyosin beta chain (TPM2).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Tropomyosin beta chain (TPM2).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Tropomyosin beta chain (TPM2).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Tropomyosin beta chain (TPM2).	[36]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Tropomyosin beta chain (TPM2).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Tropomyosin beta chain (TPM2).	[38]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Tropomyosin beta chain (TPM2).	[40]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Tropomyosin beta chain (TPM2).	[41]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Tropomyosin beta chain (TPM2).	[42]
Selenium	DM25CGV	Approved	Selenium increases the expression of Tropomyosin beta chain (TPM2).	[43]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Tropomyosin beta chain (TPM2).	[44]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Tropomyosin beta chain (TPM2).	[45]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Tropomyosin beta chain (TPM2).	[46]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Tropomyosin beta chain (TPM2).	[47]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Tropomyosin beta chain (TPM2).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Tropomyosin beta chain (TPM2).	[48]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Tropomyosin beta chain (TPM2).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Tropomyosin beta chain (TPM2).	[50]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Tropomyosin beta chain (TPM2).	[51]

References

• [1] Hypoxia-Induced TPM2 Methylation is Associated with Chemoresistance and Poor Prognosis in Breast Cancer.Cell Physiol Biochem. 2018;45(2):692-705. doi: 10.1159/000487162. Epub 2018 Jan 31.
• [2] Identification of squamous cell carcinoma associated proteins by proteomics and loss of beta tropomyosin expression in esophageal cancer.World J Gastroenterol. 2006 Nov 28;12(44):7104-12. doi: 10.3748/wjg.v12.i44.7104.
• [3] Using proteomic approach to identify tumor-associated proteins as biomarkers in human esophageal squamous cell carcinoma.J Proteome Res. 2011 Jun 3;10(6):2863-72. doi: 10.1021/pr200141c. Epub 2011 May 3.
• [4] Protein-altering MYH3 variants are associated with a spectrum of phenotypes extending to spondylocarpotarsal synostosis syndrome. Eur J Hum Genet. 2016 Dec;24(12):1746-1751. doi: 10.1038/ejhg.2016.84. Epub 2016 Jul 6.
• [5] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [6] TPM2 as a potential predictive biomarker for atherosclerosis.Aging (Albany NY). 2019 Sep 5;11(17):6960-6982. doi: 10.18632/aging.102231. Epub 2019 Sep 5.
• [7] A novel TPM2 gene splice-site mutation causes severe congenital myopathy with arthrogryposis and dysmorphic features.J Appl Genet. 2017 May;58(2):199-203. doi: 10.1007/s13353-016-0368-z. Epub 2016 Oct 10.
• [8] Mutations in fast skeletal troponin I, troponin T, and beta-tropomyosin that cause distal arthrogryposis all increase contractile function. FASEB J. 2007 Mar;21(3):896-905. doi: 10.1096/fj.06-6899com. Epub 2006 Dec 27.
• [9] Novel deletion of lysine 7 expands the clinical, histopathological and genetic spectrum of TPM2-related myopathies.Brain. 2013 Feb;136(Pt 2):508-21. doi: 10.1093/brain/aws344.
• [10] Tropomyosin 2 heterozygous knockout in mice using CRISPR-Cas9 system displays the inhibition of injury-induced epithelial-mesenchymal transition, and lens opacity.Mech Ageing Dev. 2018 Apr;171:24-30. doi: 10.1016/j.mad.2018.03.001. Epub 2018 Mar 3.
• [11] Epigenetic silencing of TPM2 contributes to colorectal cancer progression upon RhoA activation.Tumour Biol. 2016 Sep;37(9):12477-12483. doi: 10.1007/s13277-016-5103-1. Epub 2016 Jun 23.
• [12] Skeletal muscle contractile gene (TNNT3, MYH3, TPM2) mutations not found in vertical talus or clubfoot.Clin Orthop Relat Res. 2009 May;467(5):1195-200. doi: 10.1007/s11999-008-0694-5. Epub 2009 Jan 14.
• [13] Identification of a novel pathogenic mutation of the MYH3 gene in a family with distal arthrogryposis type 2B.Mol Med Rep. 2020 Jan;21(1):438-444. doi: 10.3892/mmr.2019.10820. Epub 2019 Nov 15.
• [14] A novel TNNI2 mutation causes Freeman-Sheldon syndrome in a Chinese family with an affected adult with only facial contractures.Gene. 2013 Sep 25;527(2):630-5. doi: 10.1016/j.gene.2013.06.082. Epub 2013 Jul 11.
• [15] De novo missense mutation in a constitutively expressed exon of the slow alpha-tropomyosin gene TPM3 associated with an atypical, sporadic case of nemaline myopathy.Neuromuscul Disord. 2002 Dec;12(10):947-51. doi: 10.1016/s0960-8966(02)00182-7.
• [16] Proteome and transcriptome profiling of equine myofibrillar myopathy identifies diminished peroxiredoxin 6 and altered cysteine metabolic pathways.Physiol Genomics. 2018 Dec 1;50(12):1036-1050. doi: 10.1152/physiolgenomics.00044.2018. Epub 2018 Oct 5.
• [17] Protein expression profiles in pancreatic adenocarcinoma compared with normal pancreatic tissue and tissue affected by pancreatitis as detected by two-dimensional gel electrophoresis and mass spectrometry.Cancer Res. 2004 Dec 15;64(24):9018-26. doi: 10.1158/0008-5472.CAN-04-3262.
• [18] A novel splice variant of the beta-tropomyosin (TPM2) gene in prostate cancer.Mol Carcinog. 2010 Jun;49(6):525-31. doi: 10.1002/mc.20626.
• [19] Rapamycin ameliorates psoriasis by regulating the expression and methylation levels of tropomyosin via ERK1/2 and mTOR pathways in vitro and in vivo.Exp Dermatol. 2018 Oct;27(10):1112-1119. doi: 10.1111/exd.13745. Epub 2018 Aug 3.
• [20] Cap disease caused by heterozygous deletion of the beta-tropomyosin gene TPM2.Neuromuscul Disord. 2007 Jun;17(6):433-42. doi: 10.1016/j.nmd.2007.02.015. Epub 2007 Apr 16.
• [21] Nemaline Myopathy C RETIRED CHAPTER, FOR HISTORICAL REFERENCE ONLY. 2002 Jun 19 [updated 2015 Jun 11]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [22] K7del is a common TPM2 gene mutation associated with nemaline myopathy and raised myofibre calcium sensitivity. Brain. 2013 Feb;136(Pt 2):494-507. doi: 10.1093/brain/aws348. Epub 2013 Jan 31.
• [23] Mutations in TPM2 and congenital fibre type disproportion. Neuromuscul Disord. 2012 Nov;22(11):955-8. doi: 10.1016/j.nmd.2012.06.002. Epub 2012 Jul 24.
• [24] Spectrum of mutations that cause distal arthrogryposis types 1 and 2B. Am J Med Genet A. 2013 Mar;161A(3):550-5. doi: 10.1002/ajmg.a.35809. Epub 2013 Feb 7.
• [25] Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
• [26] Characterization of mRNA Expression and Endogenous RNA Profiles in Bladder Cancer Based on The Cancer Genome Atlas (TCGA) Database.Med Sci Monit. 2019 Apr 25;25:3041-3060. doi: 10.12659/MSM.915487.
• [27] Functional Assessment of Clubfoot Associated HOXA9, TPM1, and TPM2 Variants Suggests a Potential Gene Regulation Mechanism.Clin Orthop Relat Res. 2016 Jul;474(7):1726-35. doi: 10.1007/s11999-016-4788-1. Epub 2016 Mar 28.
• [28] Pharmacogenetic tools for the development of target-oriented cognitive-enhancing drugs.NeuroRx. 2006 Jan;3(1):106-16. doi: 10.1016/j.nurx.2005.12.004.
• [29] Congenital myopathies.Curr Opin Neurol. 2007 Oct;20(5):583-9. doi: 10.1097/WCO.0b013e3282ef6e69.
• [30] Absence of beta-tropomyosin is a new cause of Escobar syndrome associated with nemaline myopathy.Neuromuscul Disord. 2009 Feb;19(2):118-23. doi: 10.1016/j.nmd.2008.11.009. Epub 2009 Jan 19.
• [31] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [32] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [33] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [34] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [37] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Quantitative Assessment of Arsenite-Induced Perturbation of Ubiquitinated Proteome. Chem Res Toxicol. 2022 Sep 19;35(9):1589-1597. doi: 10.1021/acs.chemrestox.2c00197. Epub 2022 Aug 22.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
• [42] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [43] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [44] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [45] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [46] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [47] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [48] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [51] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.