Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTABU4YV)

• DOT Name: Glycophorin-A (GYPA)
• Synonyms: MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a
• Gene Name: GYPA
• Related Disease:
  Neoplasm
  Abdominal aortic aneurysm
  Acute lymphocytic leukaemia
  Adenocarcinoma
  Anxiety
  Anxiety disorder
  Attention deficit hyperactivity disorder
  Bloom syndrome
  Breast cancer
  Breast carcinoma
  Chromosomal disorder
  Chronic obstructive pulmonary disease
  Cystic fibrosis
  Depression
  Fanconi anemia complementation group A
  Fanconi's anemia
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Hereditary spherocytosis
  High blood pressure
  leukaemia
  Lung cancer
  Lung carcinoma
  Malaria
  Melnick-Needles syndrome
  Metabolic disorder
  Microscopic polyangiitis
  Myelodysplastic syndrome
  Pulmonary disease
  Skin cancer
  Skin neoplasm
  Systemic sclerosis
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Acute erythroid leukemia
  Anti-neutrophil cytoplasmic antibody-associated vasculitis
  Non-small-cell lung cancer
  Acute myelogenous leukaemia
  Anca-associated vasculitis
  Autoimmune disease
  Chronic renal failure
  Colorectal carcinoma
  End-stage renal disease
  Leukemia
  Melanoma
  Vasculitis
  Werner syndrome
• UniProt ID: GLPA_HUMAN
• PDB ID: 1AFO; 2KPE; 2KPF; 5EH4; 5EH6; 7UZ3; 7V07; 7V0K; 7V19; 8CRQ; 8CRR; 8CRT; 8CS9; 8CSL; 8CT3; 8CTE
• Pfam ID: PF01102
• Sequence:
  MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAH
  EVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
  SPSDVKPLPSPDTDVPLSSVEIENPETSDQ
• Function: Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane. Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane; (Microbial infection) Appears to be a receptor for Hepatitis A virus (HAV); (Microbial infection) Receptor for P.falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans.
• KEGG Pathway:
  Hematopoietic cell lineage (hsa04640)
  Malaria (hsa05144)
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[2]
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[3]
Adenocarcinoma	DIS3IHTY	Strong	Genetic Variation	[4]
Anxiety	DISIJDBA	Strong	Biomarker	[5]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[5]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[5]
Bloom syndrome	DISKXQ7J	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Chromosomal disorder	DISM5BB5	Strong	Genetic Variation	[8]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[9]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[10]
Depression	DIS3XJ69	Strong	Biomarker	[5]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Genetic Variation	[11]
Fanconi's anemia	DISGW6Q8	Strong	Genetic Variation	[11]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Hereditary spherocytosis	DISQYJP5	Strong	Genetic Variation	[14]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[15]
leukaemia	DISS7D1V	Strong	Genetic Variation	[16]
Lung cancer	DISCM4YA	Strong	Biomarker	[9]
Lung carcinoma	DISTR26C	Strong	Biomarker	[9]
Malaria	DISQ9Y50	Strong	Biomarker	[17]
Melnick-Needles syndrome	DIS0KTGM	Strong	Biomarker	[18]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[19]
Microscopic polyangiitis	DIS74KSO	Strong	Biomarker	[20]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[21]
Pulmonary disease	DIS6060I	Strong	Genetic Variation	[22]
Skin cancer	DISTM18U	Strong	Biomarker	[23]
Skin neoplasm	DIS16DDV	Strong	Genetic Variation	[23]
Systemic sclerosis	DISF44L6	Strong	Genetic Variation	[24]
Thyroid cancer	DIS3VLDH	Strong	Genetic Variation	[25]
Thyroid gland carcinoma	DISMNGZ0	Strong	Genetic Variation	[25]
Thyroid tumor	DISLVKMD	Strong	Genetic Variation	[25]
Acute erythroid leukemia	DISZFC1O	moderate	Biomarker	[26]
Anti-neutrophil cytoplasmic antibody-associated vasculitis	DISBEQIT	Disputed	Biomarker	[27]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Biomarker	[28]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[29]
Anca-associated vasculitis	DISU3CNU	Limited	Genetic Variation	[30]
Autoimmune disease	DISORMTM	Limited	Biomarker	[31]
Chronic renal failure	DISGG7K6	Limited	Biomarker	[32]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[33]
End-stage renal disease	DISXA7GG	Limited	Biomarker	[32]
Leukemia	DISNAKFL	Limited	Biomarker	[3]
Melanoma	DIS1RRCY	Limited	Biomarker	[34]
Vasculitis	DISQRKDX	Limited	Biomarker	[30]
Werner syndrome	DISZY45W	Limited	Genetic Variation	[35]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Allopurinol	DMLPAOB	Approved	Glycophorin-A (GYPA) increases the Aplasia pure red cell ADR of Allopurinol.	[47]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the mutagenesis of Glycophorin-A (GYPA).	[23]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Glycophorin-A (GYPA).	[37]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Glycophorin-A (GYPA).	[38]
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the expression of Glycophorin-A (GYPA).	[39]
Teriflunomide	DMQ2FKJ	Approved	Teriflunomide increases the expression of Glycophorin-A (GYPA).	[40]
Midostaurin	DMI6E0R	Approved	Midostaurin decreases the expression of Glycophorin-A (GYPA).	[41]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Glycophorin-A (GYPA).	[42]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Glycophorin-A (GYPA).	[43]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Glycophorin-A (GYPA).	[44]
Apigenin	DMI3491	Investigative	Apigenin increases the expression of Glycophorin-A (GYPA).	[45]
Guanosine-5'-Triphosphate	DMV2OJX	Investigative	Guanosine-5'-Triphosphate increases the expression of Glycophorin-A (GYPA).	[46]

References

• [1] Chromogenic Tissue-Based Methods for Detection of Gene Amplifications (or Rearrangements) Combined with Protein Overexpression in Clinical Samples.Methods Mol Biol. 2019;1953:301-314. doi: 10.1007/978-1-4939-9145-7_19.
• [2] Blood groups and HLA antigens in patients with abdominal aortic aneurysms.Hum Hered. 1984;34(1):9-13. doi: 10.1159/000153411.
• [3] Glycophorin A mutations and risk of secondary leukaemia in patients treated for childhood acute lymphoblastic leukaemia.Br J Haematol. 1996 Apr;93(1):117-24. doi: 10.1046/j.1365-2141.1996.4621001.x.
• [4] Comparing survival predicted by the diagnosis-specific Graded Prognostic Assessment (DS-GPA) to actual survival in patients with 1-10 brain metastases treated with stereotactic radiosurgery.Radiother Oncol. 2019 Sep;138:173-179. doi: 10.1016/j.radonc.2019.06.033. Epub 2019 Jul 11.
• [5] Longitudinal Evaluation of the Cognitive-Behavioral Model of ADHD in a Sample of College Students With ADHD.J Atten Disord. 2018 Feb;22(4):323-333. doi: 10.1177/1087054715616184. Epub 2015 Dec 4.
• [6] In vivo somatic mutations in Werner's syndrome.Hum Genet. 1998 Oct;103(4):405-10. doi: 10.1007/s004390050841.
• [7] Upfront brain radiotherapy may improve survival for unfavorable prognostic breast cancer brain metastasis patients with Breast-GPA 0-2.0.Breast J. 2019 Nov;25(6):1134-1142. doi: 10.1111/tbj.13426. Epub 2019 Jul 8.
• [8] Biological dosimetry of radiation workers at the Sellafield nuclear facility.Radiat Res. 1997 Sep;148(3):216-26.
• [9] Chromosome 4q31 locus in COPD is also associated with lung cancer.Eur Respir J. 2010 Dec;36(6):1375-82. doi: 10.1183/09031936.00033310.
• [10] Linkage studies between polymorphic markers on chromosome 4 and cystic fibrosis.Hum Genet. 1985;69(3):250-4. doi: 10.1007/BF00293035.
• [11] Use of the glycophorin A somatic mutation assay for rapid, unambiguous identification of Fanconi anemia homozygotes regardless of GPA genotype.Am J Med Genet A. 2005 May 15;135(1):59-65. doi: 10.1002/ajmg.a.30687.
• [12] Genetic survey of an isolated community in Bali, Indonesia. I. Blood groups, serum proteins and hepatitis B serology.Hum Hered. 1982;32(1):52-61. doi: 10.1159/000153259.
• [13] Evidence for increased somatic cell mutations in patients with hepatocellular carcinoma.Carcinogenesis. 1997 Feb;18(2):445-9. doi: 10.1093/carcin/18.2.445.
• [14] Interaction of anion exchanger 1 and glycophorin A in human erythroleukaemic K562 cells.Biochem J. 2009 Jul 15;421(3):345-56. doi: 10.1042/BJ20090345.
• [15] Adducin in essential hypertension.FEBS Lett. 1998 Jun 23;430(1-2):41-4. doi: 10.1016/s0014-5793(98)00457-8.
• [16] Somatic mutations at T-cell antigen receptor and glycophorin A loci in pediatric leukemia patients following chemotherapy: comparison with HPRT locus mutation.Mutat Res. 1994 Sep;315(2):95-103. doi: 10.1016/0921-8777(94)90010-8.
• [17] An ImmunoPEGliposome for Targeted Antimalarial Combination Therapy at the Nanoscale.Pharmaceutics. 2019 Jul 16;11(7):341. doi: 10.3390/pharmaceutics11070341.
• [18] Frequency of Red Blood Cell Antigens According to Parent Ethnicity in Korea Using Molecular Typing.Ann Lab Med. 2018 Nov;38(6):599-603. doi: 10.3343/alm.2018.38.6.599.
• [19] -guanidinopropionic acid and metformin differentially impact autophagy, mitochondria and cellular morphology in developing C2C12 muscle cells.J Muscle Res Cell Motil. 2020 Sep;41(2-3):221-237. doi: 10.1007/s10974-019-09568-0. Epub 2019 Dec 13.
• [20] Brief Report: Circulating Cytokine Profiles and Antineutrophil Cytoplasmic Antibody Specificity in Patients With Antineutrophil Cytoplasmic Antibody-Associated Vasculitis.Arthritis Rheumatol. 2018 Jul;70(7):1114-1121. doi: 10.1002/art.40471. Epub 2018 May 7.
• [21] Purification of Bone Marrow Clonal Cells from Patients with Myelodysplastic Syndrome via IGF-IR.PLoS One. 2015 Oct 15;10(10):e0140372. doi: 10.1371/journal.pone.0140372. eCollection 2015.
• [22] Analysis of erythrocyte glycophorin-A variants by flow cytometry in lung disease patients detects the effect of tobacco smoke.Anal Cell Pathol. 2000;21(1):35-40. doi: 10.1155/2000/512786.
• [23] Increased glycophorin A somatic cell variant frequency in arsenic-exposed patients of Guizhou, China. Toxicol Lett. 2006 Nov 1;167(1):47-53. doi: 10.1016/j.toxlet.2006.08.008. Epub 2006 Sep 1.
• [24] Genomic instability in scleroderma.Asian Pac J Allergy Immunol. 2004 Jun-Sep;22(2-3):153-8.
• [25] Improved determination of variant erythrocytes at the glycophorin A (GPA) locus and variant frequency in patients treated with radioiodine for thyroid cancer.Int J Radiat Biol. 1996 Aug;70(2):131-43. doi: 10.1080/095530096145120.
• [26] DKC1 is a transcriptional target of GATA1 and drives upregulation of telomerase activity in normal human erythroblasts.Haematologica. 2020 Jun;105(6):1517-1526. doi: 10.3324/haematol.2018.215699. Epub 2019 Aug 14.
• [27] Update on ANCA-associated vasculitis: from biomarkers to therapy.J Nephrol. 2019 Dec;32(6):871-882. doi: 10.1007/s40620-019-00628-9. Epub 2019 Jul 12.
• [28] Optimal management of brain metastases in oncogenic-driven non-small cell lung cancer (NSCLC).Lung Cancer. 2019 Mar;129:63-71. doi: 10.1016/j.lungcan.2018.12.009. Epub 2018 Dec 10.
• [29] S-phase DNA content and aneuploidy of immunophenotypic defined subpopulations in acute myeloid leukemia determined by multi-parameter flow cytometry.Leuk Res. 1991;15(9):827-35. doi: 10.1016/0145-2126(91)90467-8.
• [30] Severe localised granulomatosis with polyangiitis (Wegener's granulomatosis) manifesting with extensive cranial nerve palsies and cranial diabetes insipidus: a case report and literature review.BMC Neurol. 2018 May 1;18(1):59. doi: 10.1186/s12883-018-1058-8.
• [31] Genetic aspects of anti-neutrophil cytoplasmic antibody-associated vasculitis.Nephrol Dial Transplant. 2015 Apr;30 Suppl 1:i37-45. doi: 10.1093/ndt/gfu386. Epub 2014 Dec 18.
• [32] Improving Mortality in End-Stage Renal Disease Due to Granulomatosis With Polyangiitis (Wegener's) From 1995 to 2014: Data From the United States Renal Data System.Arthritis Care Res (Hoboken). 2018 Oct;70(10):1495-1500. doi: 10.1002/acr.23521. Epub 2018 Sep 1.
• [33] Sixty years of follow-up of Hiroshima and Nagasaki survivors: current progress in molecular epidemiology studies.Mutat Res. 2008 Jul-Aug;659(1-2):109-17. doi: 10.1016/j.mrrev.2008.02.001. Epub 2008 Feb 12.
• [34] Validation of the Chowdhury overall survival score in patients with melanoma brain metastasis treated with Gamma Knife Radiosurgery.J Neurooncol. 2018 Jun;138(2):391-399. doi: 10.1007/s11060-018-2808-6. Epub 2018 Feb 22.
• [35] Genetic instability and hematologic disease risk in Werner syndrome patients and heterozygotes.Cancer Res. 2000 May 1;60(9):2492-6.
• [36] Increased glycophorin A somatic cell variant frequency in arsenic-exposed patients of Guizhou, China. Toxicol Lett. 2006 Nov 1;167(1):47-53. doi: 10.1016/j.toxlet.2006.08.008. Epub 2006 Sep 1.
• [37] In vitro dual effect of arsenic trioxide on hemopoiesis: inhibition of erythropoiesis and stimulation of megakaryocytic maturation. Blood Cells Mol Dis. 2006 Jan-Feb;36(1):59-76. doi: 10.1016/j.bcmd.2005.10.005. Epub 2005 Dec 15.
• [38] Phenolic metabolites of benzene inhibited the erythroid differentiation of K562 cells. Toxicol Lett. 2011 Jun 24;203(3):190-9. doi: 10.1016/j.toxlet.2011.03.012. Epub 2011 Mar 23.
• [39] Selective toxicity of dihydroartemisinin on human CD34+ erythroid cell differentiation. Toxicology. 2010 Oct 9;276(2):128-34. doi: 10.1016/j.tox.2010.07.016. Epub 2010 Aug 3.
• [40] A77 1726 induces differentiation of human myeloid leukemia K562 cells by depletion of intracellular CTP pools. Mol Pharmacol. 2002 Sep;62(3):463-72. doi: 10.1124/mol.62.3.463.
• [41] Oral small-molecule tyrosine kinase inhibitor midostaurin (PKC412) inhibits growth and induces megakaryocytic differentiation in human leukemia cells. Toxicol In Vitro. 2009 Sep;23(6):979-85. doi: 10.1016/j.tiv.2009.06.027. Epub 2009 Jun 30.
• [42] Resveratrol induces human K562 cell apoptosis, erythroid differentiation, and autophagy. Tumour Biol. 2014 Jun;35(6):5381-8. doi: 10.1007/s13277-014-1701-y. Epub 2014 Feb 15.
• [43] p22phox-dependent NADPH oxidase activity is required for megakaryocytic differentiation. Cell Death Differ. 2010 Dec;17(12):1842-54. doi: 10.1038/cdd.2010.67. Epub 2010 Jun 4.
• [44] Inhibitory effect of tellimagrandin I on chemically induced differentiation of human leukemia K562 cells. Toxicol Lett. 2004 Mar 1;147(2):109-19. doi: 10.1016/j.toxlet.2003.12.008.
• [45] Analysis of the erythroid differentiation effect of flavonoid apigenin on K562 human chronic leukemia cells. Chem Biol Interact. 2014 Sep 5;220:269-77. doi: 10.1016/j.cbi.2014.07.006. Epub 2014 Jul 21.
• [46] GTP induces S-phase cell-cycle arrest and inhibits DNA synthesis in K562 cells but not in normal human peripheral lymphocytes. J Biochem Mol Biol. 2006 Sep 30;39(5):492-501. doi: 10.5483/bmbrep.2006.39.5.492.
• [47] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.