Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB0DRMS)

• DOT Name: Collagen alpha-1(XI) chain (COL11A1)
• Synonyms: Collagen alpha-1(XI) chain
• Gene Name: COL11A1
• Related Disease:
  Fibrochondrogenesis 1
  Marshall syndrome
  Myopia
  Primary angle-closure glaucoma
  Stickler syndrome type 2
  Achromatopsia 3
  Angle-closure glaucoma
  Breast cancer
  Cleft palate
  Colorectal carcinoma
  Ductal breast carcinoma in situ
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Hearing loss, autosomal dominant 37
  Isolated Pierre-Robin syndrome
  Knee osteoarthritis
  Neoplasm
  Open-angle glaucoma
  Osteoarthritis
  Osteochondrodysplasia
  Ovarian cancer
  Ovarian neoplasm
  Retinitis pigmentosa 45
  Sensorineural hearing loss disorder
  Spondyloepiphyseal dysplasia
  Squamous cell carcinoma
  Stickler syndrome
  Stickler syndrome type 1
  Metastatic malignant neoplasm
  Non-small-cell lung cancer
  Autosomal dominant myopia-midfacial retrusion-sensorineural hearing loss-rhizomelic dysplasia syndrome
  Fibrochondrogenesis
  Obsolete autosomal recessive Stickler syndrome
  Advanced cancer
  Chronic pancreatitis
  Glaucoma/ocular hypertension
  Hyperostosis corticalis generalisata
  Melnick-Needles syndrome
  Multiple epiphyseal dysplasia
  Otospondylomegaepiphyseal dysplasia, autosomal dominant
  Pancreatic cancer
  Schwartz-Jampel syndrome
  Schwartz-Jampel syndrome type 1
  Spondyloepiphyseal dysplasia tarda, X-linked
  Wagner disease
• UniProt ID: COBA1_HUMAN
• Pfam ID: PF01410 ; PF01391 ; PF02210
• Sequence:
  MEPWSSRWKTKRWLWDFTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGF
  CTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYN
  EHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIV
  DCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYS
  PDCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEA
  NIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLY
  ENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSINGHG
  AYGEKGQKGEPAVVEPGMLVEGPPGPAGPAGIMGPPGLQGPTGPPGDPGDRGPPGRPGLP
  GADGLPGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGRP
  GPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDR
  GFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTP
  GAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKP
  GLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEK
  GEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVP
  GLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKP
  GPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKT
  GPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGISGKD
  GPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTAGPIGLPGRPGPQ
  GPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSK
  GDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGLQ
  GLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSVGSVGGVGEKGEPGEA
  GNPGPPGEAGVGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGPP
  GEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGAEGRQGEKGAK
  GEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPMGPPGLP
  GLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGIPGPAGPLGPP
  GPPGLPGPQGPKGNKGSTGPAGQKGDSGLPGPPGSPGPPGEVIQPLPILSSKKTRRHTEG
  MQADADDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDG
  EYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKL
  LSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDE
  EMSYDNNPFIKTLYDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVG
  PVCFLG
• Function: May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
• Tissue Specificity: Cartilage, placenta and some tumor or virally transformed cell lines. Isoforms using exon IIA or IIB are found in the cartilage while isoforms using only exon IIB are found in the tendon.
• KEGG Pathway:
  Cytoskeleton in muscle cells (hsa04820)
  Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  MET activates PTK2 signaling (R-HSA-8874081)
  Collagen chain trimerization (R-HSA-8948216)
  Collagen degradation (R-HSA-1442490)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Fibrochondrogenesis 1	DISAH73G	Definitive	Autosomal recessive	[1]
Marshall syndrome	DISADTID	Definitive	Autosomal recessive	[2]
Myopia	DISK5S60	Definitive	Biomarker	[3]
Primary angle-closure glaucoma	DISX8UKZ	Definitive	Genetic Variation	[4]
Stickler syndrome type 2	DIS4AZNW	Definitive	Autosomal dominant	[5]
Achromatopsia 3	DISR4EMI	Strong	Biomarker	[6]
Angle-closure glaucoma	DISZ95KY	Strong	Genetic Variation	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Cleft palate	DIS6G5TF	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[9]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[12]
Hearing loss, autosomal dominant 37	DISPPMAF	Strong	Autosomal dominant	[13]
Isolated Pierre-Robin syndrome	DISVEHG7	Strong	Genetic Variation	[8]
Knee osteoarthritis	DISLSNBJ	Strong	Genetic Variation	[14]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[15]
Open-angle glaucoma	DISSZEE8	Strong	Genetic Variation	[16]
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[14]
Osteochondrodysplasia	DIS9SPWW	Strong	Genetic Variation	[17]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[11]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[11]
Retinitis pigmentosa 45	DISTLR67	Strong	Biomarker	[6]
Sensorineural hearing loss disorder	DISJV45Z	Strong	Genetic Variation	[18]
Spondyloepiphyseal dysplasia	DIS1JG9A	Strong	Biomarker	[19]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[20]
Stickler syndrome	DISQWFHN	Strong	Genetic Variation	[21]
Stickler syndrome type 1	DIST5L4S	Strong	Genetic Variation	[21]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[22]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Biomarker	[15]
Autosomal dominant myopia-midfacial retrusion-sensorineural hearing loss-rhizomelic dysplasia syndrome	DISGSFBV	Supportive	Autosomal dominant	[17]
Fibrochondrogenesis	DIS8RUBC	Supportive	Autosomal dominant	[1]
Obsolete autosomal recessive Stickler syndrome	DISCSIL9	Supportive	Autosomal recessive	[23]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[24]
Chronic pancreatitis	DISBUOMJ	Limited	Altered Expression	[25]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Biomarker	[26]
Hyperostosis corticalis generalisata	DISR4BHB	Limited	Biomarker	[19]
Melnick-Needles syndrome	DIS0KTGM	Limited	Biomarker	[19]
Multiple epiphyseal dysplasia	DIS5FZLR	Limited	Biomarker	[19]
Otospondylomegaepiphyseal dysplasia, autosomal dominant	DISZ5155	Limited	Biomarker	[27]
Pancreatic cancer	DISJC981	Limited	Biomarker	[28]
Schwartz-Jampel syndrome	DIS3HCR8	Limited	Biomarker	[19]
Schwartz-Jampel syndrome type 1	DIS42TKQ	Limited	Biomarker	[19]
Spondyloepiphyseal dysplasia tarda, X-linked	DIS9EL3M	Limited	Biomarker	[19]
Wagner disease	DISAJ1K0	Limited	Biomarker	[29]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Collagen alpha-1(XI) chain (COL11A1) affects the response to substance of Mitoxantrone.	[49]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[30]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Collagen alpha-1(XI) chain (COL11A1).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Collagen alpha-1(XI) chain (COL11A1).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Collagen alpha-1(XI) chain (COL11A1).	[33]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Collagen alpha-1(XI) chain (COL11A1).	[34]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[35]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Collagen alpha-1(XI) chain (COL11A1).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[37]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[38]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Collagen alpha-1(XI) chain (COL11A1).	[33]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Collagen alpha-1(XI) chain (COL11A1).	[39]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[37]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[40]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[41]
Ibuprofen	DM8VCBE	Approved	Ibuprofen affects the expression of Collagen alpha-1(XI) chain (COL11A1).	[42]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[43]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Collagen alpha-1(XI) chain (COL11A1).	[44]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[47]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Collagen alpha-1(XI) chain (COL11A1).	[48]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Collagen alpha-1(XI) chain (COL11A1).	[46]

References

• [1] Fibrochondrogenesis results from mutations in the COL11A1 type XI collagen gene. Am J Hum Genet. 2010 Nov 12;87(5):708-12. doi: 10.1016/j.ajhg.2010.10.009. Epub 2010 Oct 28.
• [2] A recessive form of Marshall syndrome is caused by a mutation in the COL11A1 gene. J Med Genet. 2012 Apr;49(4):246-8. doi: 10.1136/jmedgenet-2012-100783.
• [3] Genetic Association Study Between the COL11A1 and COL18A1 Genes and High Myopia in a Han Chinese Population.Genet Test Mol Biomarkers. 2018 Jun;22(6):359-365. doi: 10.1089/gtmb.2017.0235. Epub 2018 May 21.
• [4] COL11A1 Polymorphisms Are Associated with Primary Angle-Closure Glaucoma Severity.J Ophthalmol. 2019 Jan 27;2019:2604386. doi: 10.1155/2019/2604386. eCollection 2019.
• [5] Marshall syndrome: further evidence of a distinct phenotypic entity and report of new findings. Am J Med Genet A. 2014 Oct;164A(10):2601-6. doi: 10.1002/ajmg.a.36681. Epub 2014 Jul 29.
• [6] A family with Stickler syndrome type 2 has a mutation in the COL11A1 gene resulting in the substitution of glycine 97 by valine in alpha 1 (XI) collagen.Hum Mol Genet. 1996 Sep;5(9):1339-43. doi: 10.1093/hmg/5.9.1339.
• [7] Development of novel real-time PCR methodology for quantification of COL11A1 mRNA variants and evaluation in breast cancer tissue specimens.BMC Cancer. 2015 Oct 14;15:694. doi: 10.1186/s12885-015-1725-8.
• [8] Collagen XI sequence variations in nonsyndromic cleft palate, Robin sequence and micrognathia.Eur J Hum Genet. 2003 Mar;11(3):265-70. doi: 10.1038/sj.ejhg.5200950.
• [9] Colorectal carcinogenesis is associated with stromal expression of COL11A1 and COL5A2.Carcinogenesis. 2001 Jun;22(6):875-8. doi: 10.1093/carcin/22.6.875.
• [10] Collagen (XI) alpha-1 chain is an independent prognostic factor in breast ductal carcinoma in situ.Mod Pathol. 2019 Oct;32(10):1460-1472. doi: 10.1038/s41379-019-0286-9. Epub 2019 Jun 7.
• [11] Inhibitor of apoptosis proteins (IAPs) mediate collagen type XI alpha 1-driven cisplatin resistance in ovarian cancer.Oncogene. 2018 Aug;37(35):4809-4820. doi: 10.1038/s41388-018-0297-x. Epub 2018 May 17.
• [12] The clinical significance of collagen family gene expression in esophageal squamous cell carcinoma.PeerJ. 2019 Oct 4;7:e7705. doi: 10.7717/peerj.7705. eCollection 2019.
• [13] Splice-altering variant in COL11A1 as a cause of nonsyndromic hearing loss DFNA37. Genet Med. 2019 Apr;21(4):948-954. doi: 10.1038/s41436-018-0285-0. Epub 2018 Sep 24.
• [14] Identification of new therapeutic targets for osteoarthritis through genome-wide analyses of UK Biobank data. Nat Genet. 2019 Feb;51(2):230-236.
• [15] Development of novel real-time RT-qPCR methodologies for quantification of the COL11A1 mRNA general and C transcripts and evaluation in non-small cell lung cancer specimens.J BUON. 2018 Nov-Dec;23(6):1699-1710.
• [16] A multiethnic genome-wide association study of primary open-angle glaucoma identifies novel risk loci.Nat Commun. 2018 Jun 11;9(1):2278. doi: 10.1038/s41467-018-04555-4.
• [17] A novel dominant COL11A1 mutation resulting in a severe skeletal dysplasia. Am J Med Genet A. 2014 Oct;164A(10):2607-12. doi: 10.1002/ajmg.a.36688. Epub 2014 Aug 4.
• [18] Homozygous variants in AMPD2 and COL11A1 lead to a complex phenotype of pontocerebellar hypoplasia type 9 and Stickler syndrome type 2.Am J Med Genet A. 2020 Mar;182(3):557-560. doi: 10.1002/ajmg.a.61452. Epub 2019 Dec 12.
• [19] Craniofacial cartilage morphogenesis requires zebrafish col11a1 activity.Matrix Biol. 2009 Oct;28(8):490-502. doi: 10.1016/j.matbio.2009.07.004. Epub 2009 Jul 26.
• [20] Collagen type XI 1 facilitates head and neck squamous cell cancer growth and invasion.Br J Cancer. 2013 Dec 10;109(12):3049-56. doi: 10.1038/bjc.2013.624. Epub 2013 Nov 14.
• [21] A mild form of Stickler syndrome type II caused by mosaicism of COL11A1.Eur J Med Genet. 2017 May;60(5):275-278. doi: 10.1016/j.ejmg.2017.03.005. Epub 2017 Mar 14.
• [22] Cancer-associated stroma significantly contributes to the mesenchymal subtype signature of serous ovarian cancer.Gynecol Oncol. 2019 Feb;152(2):368-374. doi: 10.1016/j.ygyno.2018.11.014. Epub 2018 Nov 15.
• [23] Alternative splicing modifies the effect of mutations in COL11A1 and results in recessive type 2 Stickler syndrome with profound hearing loss. J Med Genet. 2013 Nov;50(11):765-71. doi: 10.1136/jmedgenet-2012-101499. Epub 2013 Aug 6.
• [24] Comparative genomic analysis of collagen gene diversity.3 Biotech. 2019 Mar;9(3):83. doi: 10.1007/s13205-019-1616-9. Epub 2019 Feb 14.
• [25] Gene Expression of Col11A1 Is a Marker Not only for Pancreas Carcinoma But also for Adenocarcinoma of the Papilla of Vater, Discriminating Between Carcinoma and Chronic Pancreatitis.Anticancer Res. 2015 Nov;35(11):6153-8.
• [26] Extended association study of PLEKHA7 and COL11A1 with primary angle closure glaucoma in a Han Chinese population.Invest Ophthalmol Vis Sci. 2014 May 22;55(6):3797-802. doi: 10.1167/iovs.14-14370.
• [27] Ultrastructural changes of cochlea in mice with hereditary chondrodysplasia (cho/cho).Ann N Y Acad Sci. 1991;630:259-61. doi: 10.1111/j.1749-6632.1991.tb19598.x.
• [28] Integrated whole genome microarray analysis and immunohistochemical assay identifies COL11A1, GJB2 and CTRL as predictive biomarkers for pancreatic cancer.Cancer Cell Int. 2018 Nov 6;18:174. doi: 10.1186/s12935-018-0669-x. eCollection 2018.
• [29] Posterior chorioretinal atrophy and vitreous phenotype in a family with Stickler syndrome from a mutation in the COL2A1 gene.Ophthalmology. 2003 Jan;110(1):70-7. doi: 10.1016/s0161-6420(02)01446-x.
• [30] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [31] Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
• [32] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [33] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [34] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [35] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [36] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [37] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [38] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [39] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [40] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [41] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [42] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [43] Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
• [44] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [45] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [46] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [47] Genome-wide gene expression profiling of low-dose, long-term exposure of human osteosarcoma cells to bisphenol A and its analogs bisphenols AF and S. Toxicol In Vitro. 2015 Aug;29(5):1060-9.
• [48] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [49] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.