Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB26UJJ)

• DOT Name: Very long chain fatty acid elongase 6 (ELOVL6)
• Synonyms: EC 2.3.1.199; 3-keto acyl-CoA synthase ELOVL6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Elongation of very long chain fatty acids protein 6; Fatty acid elongase 2; hELO2; Fatty acyl-CoA elongase; Long-chain fatty-acyl elongase; Very long chain 3-ketoacyl-CoA synthase 6; Very long chain 3-oxoacyl-CoA synthase 6
• Gene Name: ELOVL6
• Related Disease:
  Acute myelogenous leukaemia
  Arteriosclerosis
  Atherosclerosis
  Cardiac failure
  Congestive heart failure
  Dermatitis
  Fanconi anemia complementation group A
  Fanconi's anemia
  Hepatocellular carcinoma
  Hyperinsulinemia
  Lung cancer
  Lung carcinoma
  Metabolic disorder
  Myocardial infarction
  Neoplasm
  Non-alcoholic fatty liver disease
  Non-insulin dependent diabetes
  Obesity
  Pulmonary fibrosis
  Retinitis pigmentosa
  Benign prostatic hyperplasia
  Non-alcoholic steatohepatitis
  Advanced cancer
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Psoriatic arthritis
  Allergic contact dermatitis
  Atopic dermatitis
• UniProt ID: ELOV6_HUMAN
• EC Number: 2.3.1.199
• Pfam ID: PF01151
• Sequence:
  MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
  KPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSK
  APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY
  YALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYL
  SYLVLFCHFFFEAYIGKMRKTTKAE
• Function: Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that elongates fatty acids with 12, 14 and 16 carbons with higher activity toward C16:0 acyl-CoAs. Catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
• Tissue Specificity: Ubiquitous.
• KEGG Pathway:
  Fatty acid elongation (hsa00062)
  Biosynthesis of unsaturated fatty acids (hsa01040)
  Metabolic pathways (hsa01100)
  Fatty acid metabolism (hsa01212)
• Reactome Pathway:
  Synthesis of very long-chain fatty acyl-CoAs (R-HSA-75876)
  Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)
• BioCyc Pathway: MetaCyc:HS10142-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Definitive	Genetic Variation	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[2]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Cardiac failure	DISDC067	Strong	Biomarker	[3]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[3]
Dermatitis	DISY5SZC	Strong	Altered Expression	[4]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Genetic Variation	[5]
Fanconi's anemia	DISGW6Q8	Strong	Genetic Variation	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[7]
Lung cancer	DISCM4YA	Strong	Altered Expression	[8]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[8]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[9]
Myocardial infarction	DIS655KI	Strong	Biomarker	[10]
Neoplasm	DISZKGEW	Strong	Altered Expression	[6]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[9]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[11]
Obesity	DIS47Y1K	Strong	Biomarker	[12]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[13]
Retinitis pigmentosa	DISCGPY8	Strong	Biomarker	[14]
Benign prostatic hyperplasia	DISI3CW2	moderate	Genetic Variation	[15]
Non-alcoholic steatohepatitis	DIST4788	moderate	Biomarker	[16]
Advanced cancer	DISAT1Z9	Disputed	Altered Expression	[17]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Disputed	Altered Expression	[17]
Liver cancer	DISDE4BI	Disputed	Altered Expression	[17]
Psoriatic arthritis	DISLWTG2	Disputed	Genetic Variation	[18]
Allergic contact dermatitis	DISFFVF9	Limited	Genetic Variation	[19]
Atopic dermatitis	DISTCP41	Limited	Altered Expression	[20]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[21]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[22]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[25]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[26]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[27]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[28]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[29]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[30]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[31]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[32]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[33]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[34]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[35]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[37]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[38]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[39]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[40]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[41]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[42]
T0901317	DMZQVDI	Investigative	T0901317 increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[43]
CITCO	DM0N634	Investigative	CITCO increases the expression of Very long chain fatty acid elongase 6 (ELOVL6).	[44]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Very long chain fatty acid elongase 6 (ELOVL6).	[36]

References

• [1] A novel t(4;16)(q25;q23.1) associated with EGF and ELOVL6 deregulation in acute myeloid leukemia.Gene. 2013 Oct 15;529(1):144-7. doi: 10.1016/j.gene.2013.07.105. Epub 2013 Aug 9.
• [2] Elongation of Long-Chain Fatty Acid Family Member 6 (Elovl6)-Driven Fatty Acid Metabolism Regulates Vascular Smooth Muscle Cell Phenotype Through AMP-Activated Protein Kinase/Krppel-Like Factor 4 (AMPK/KLF4) Signaling.J Am Heart Assoc. 2016 Nov 23;5(12):e004014. doi: 10.1161/JAHA.116.004014.
• [3] Inhibition of G-protein-coupled Receptor Kinase 2 Prevents the Dysfunctional Cardiac Substrate Metabolism in Fatty Acid Synthase Transgenic Mice. J Biol Chem. 2016 Feb 5;291(6):2583-600. doi: 10.1074/jbc.M115.702688. Epub 2015 Dec 15.
• [4] Elovl6 regulates mechanical damage-induced keratinocyte death and skin inflammation.Cell Death Dis. 2018 Dec 5;9(12):1181. doi: 10.1038/s41419-018-1226-1.
• [5] The genomic organization of the Fanconi anemia group A (FAA) gene.Genomics. 1997 May 1;41(3):309-14. doi: 10.1006/geno.1997.4675.
• [6] Decreased expression levels of ELOVL6 indicate poor prognosis in hepatocellular carcinoma.Oncol Lett. 2019 Dec;18(6):6214-6220. doi: 10.3892/ol.2019.10974. Epub 2019 Oct 9.
• [7] Elovl6 Deficiency Improves Glycemic Control in Diabetic db/db Mice by Expanding -Cell Mass and Increasing Insulin Secretory Capacity.Diabetes. 2017 Jul;66(7):1833-1846. doi: 10.2337/db16-1277. Epub 2017 May 1.
• [8] Correction: LCE: an open web portal to explore gene expression and clinical associations in lung cancer.Oncogene. 2020 Jan;39(3):718-719. doi: 10.1038/s41388-019-1000-6.
• [9] Hepatocyte ELOVL Fatty Acid Elongase 6 Determines Ceramide Acyl-Chain Length and Hepatic Insulin Sensitivity in Mice.Hepatology. 2020 May;71(5):1609-1625. doi: 10.1002/hep.30953. Epub 2020 Feb 7.
• [10] Automatic high-resolution infarct detection using volumetric multiphase dual-energy CT.J Cardiovasc Comput Tomogr. 2017 Jul-Aug;11(4):288-294. doi: 10.1016/j.jcct.2017.04.006. Epub 2017 Apr 18.
• [11] Risk of diabetes associated with fatty acids in the de novo lipogenesis pathway is independent of insulin sensitivity and response: the Insulin Resistance Atherosclerosis Study (IRAS).BMJ Open Diabetes Res Care. 2019 Sep 4;7(1):e000691. doi: 10.1136/bmjdrc-2019-000691. eCollection 2019.
• [12] Elovl6: a new player in fatty acid metabolism and insulin sensitivity.J Mol Med (Berl). 2009 Apr;87(4):379-84. doi: 10.1007/s00109-009-0449-0. Epub 2009 Mar 4.
• [13] Deranged fatty acid composition causes pulmonary fibrosis in Elovl6-deficient mice.Nat Commun. 2013;4:2563. doi: 10.1038/ncomms3563.
• [14] Baldspot/ELOVL6 is a conserved modifier of disease and the ER stress response.PLoS Genet. 2018 Aug 6;14(8):e1007557. doi: 10.1371/journal.pgen.1007557. eCollection 2018 Aug.
• [15] Heritability and genome-wide association study of benign prostatic hyperplasia (BPH) in the eMERGE network.Sci Rep. 2019 Apr 15;9(1):6077. doi: 10.1038/s41598-019-42427-z.
• [16] Elovl6 promotes nonalcoholic steatohepatitis.Hepatology. 2012 Dec;56(6):2199-208. doi: 10.1002/hep.25932.
• [17] Elovl6 is a negative clinical predictor for liver cancer and knockdown of Elovl6 reduces murine liver cancer progression.Sci Rep. 2018 Apr 26;8(1):6586. doi: 10.1038/s41598-018-24633-3.
• [18] Association of the late cornified envelope-3 genes with psoriasis and psoriatic arthritis: a systematic review.J Genet Genomics. 2015 Feb 20;42(2):49-56. doi: 10.1016/j.jgg.2015.01.001. Epub 2015 Jan 10.
• [19] Deletion of the late cornified envelope genes LCE3B and LCE3C may promote chronic hand eczema with allergic contact dermatitis.J Investig Allergol Clin Immunol. 2011;21(6):472-9.
• [20] Lipid abnormalities in atopic skin are driven by type 2 cytokines.JCI Insight. 2018 Feb 22;3(4):e98006. doi: 10.1172/jci.insight.98006. eCollection 2018 Feb 22.
• [21] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [22] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [23] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [24] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [27] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [28] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [29] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [30] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [31] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [32] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [33] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [34] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [35] Hepatic cells derived from human skin progenitors show a typical phospholipidotic response upon exposure to amiodarone. Toxicol Lett. 2018 Mar 1;284:184-194. doi: 10.1016/j.toxlet.2017.11.014. Epub 2017 Dec 15.
• [36] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [37] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [38] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [39] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [40] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [41] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [42] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [43] Effects of antiepileptic drugs on lipogenic gene regulation and hyperlipidemia risk in Taiwan: a nationwide population-based cohort study and supporting in vitro studies. Arch Toxicol. 2018 Sep;92(9):2829-2844. doi: 10.1007/s00204-018-2263-3. Epub 2018 Jul 13.
• [44] Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.