Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBDSLE7)

• DOT Name: MICOS complex subunit MIC60 (IMMT)
• Synonyms: Cell proliferation-inducing gene 4/52 protein; Mitochondrial inner membrane protein; Mitofilin; p87/89
• Gene Name: IMMT
• Related Disease:
  Benign prostatic hyperplasia
  Breast cancer
  Breast carcinoma
  Isolated congenital microcephaly
  Nervous system disease
  Parkinson disease
  Alzheimer disease
  Anthrax
  Blast phase chronic myelogenous leukemia, BCR-ABL1 positive
  Brain neoplasm
  Classic Hodgkin lymphoma
  Familial hypertrophic cardiomyopathy
  Fanconi anemia complementation group A
  Hepatitis C virus infection
  Huntington disease
  Hypertrophic cardiomyopathy
  Leber hereditary optic neuropathy
  Lung adenocarcinoma
  Multiple sclerosis
  Neuromuscular disease
  Peripheral neuropathy
  Pneumonia
  Pneumonitis
  Progressive familial intrahepatic cholestasis
  Progressive familial intrahepatic cholestasis type 1
  Prostate cancer
  Prostate carcinoma
  Schizophrenia
  Usher syndrome
  Autosomal dominant optic atrophy, classic form
  Intellectual disability
  Lung cancer
  Lung carcinoma
  Malignant tumor of nasopharynx
  Nasopharyngeal carcinoma
  Neurofibromatosis
  Neurofibromatosis type 1
  Sensorineural hearing loss disorder
  Type-1/2 diabetes
  Cardiomyopathy
  Colorectal carcinoma
  Hereditary spastic paraplegia
  Inflammatory bowel disease
  Neuroblastoma
  Osteoarthritis
• UniProt ID: MIC60_HUMAN
• Pfam ID: PF09731
• Sequence:
  MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGG
  TILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKE
  SKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGK
  PTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIA
  AQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKE
  ELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHE
  LVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELA
  EQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMR
  TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDIN
  TAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIK
  ANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFL
  SYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRV
  AQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE
• Function: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology.
• Reactome Pathway: Cristae formation (R-HSA-8949613)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Benign prostatic hyperplasia	DISI3CW2	Definitive	Biomarker	[1]
Breast cancer	DIS7DPX1	Definitive	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Definitive	Altered Expression	[2]
Isolated congenital microcephaly	DISUXHZ6	Definitive	Genetic Variation	[3]
Nervous system disease	DISJ7GGT	Definitive	Biomarker	[4]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Anthrax	DISFPT78	Strong	Biomarker	[6]
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive	DIS3KLUX	Strong	Altered Expression	[7]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[8]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Altered Expression	[9]
Familial hypertrophic cardiomyopathy	DISQ89HN	Strong	Biomarker	[10]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Biomarker	[11]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[12]
Huntington disease	DISQPLA4	Strong	Altered Expression	[9]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[13]
Leber hereditary optic neuropathy	DIS7Y2EE	Strong	Genetic Variation	[14]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[15]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[16]
Neuromuscular disease	DISQTIJZ	Strong	Genetic Variation	[17]
Peripheral neuropathy	DIS7KN5G	Strong	Genetic Variation	[18]
Pneumonia	DIS8EF3M	Strong	Biomarker	[19]
Pneumonitis	DIS88E0K	Strong	Biomarker	[19]
Progressive familial intrahepatic cholestasis	DIS3J8HT	Strong	Genetic Variation	[20]
Progressive familial intrahepatic cholestasis type 1	DISU0AJE	Strong	Genetic Variation	[20]
Prostate cancer	DISF190Y	Strong	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[1]
Schizophrenia	DISSRV2N	Strong	Biomarker	[21]
Usher syndrome	DIS9YIS7	Strong	Biomarker	[22]
Autosomal dominant optic atrophy, classic form	DISXUAV9	moderate	Biomarker	[23]
Intellectual disability	DISMBNXP	moderate	Biomarker	[24]
Lung cancer	DISCM4YA	moderate	Altered Expression	[25]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[25]
Malignant tumor of nasopharynx	DISTGIGF	moderate	Genetic Variation	[26]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Genetic Variation	[26]
Neurofibromatosis	DIS5N2R6	moderate	Biomarker	[27]
Neurofibromatosis type 1	DIS53JH9	moderate	Biomarker	[27]
Sensorineural hearing loss disorder	DISJV45Z	moderate	Biomarker	[28]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[29]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[30]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[31]
Hereditary spastic paraplegia	DISGZQV1	Limited	Genetic Variation	[32]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[33]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[34]
Osteoarthritis	DIS05URM	Limited	Biomarker	[35]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of MICOS complex subunit MIC60 (IMMT).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of MICOS complex subunit MIC60 (IMMT).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of MICOS complex subunit MIC60 (IMMT).	[38]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of MICOS complex subunit MIC60 (IMMT).	[39]
Irinotecan	DMP6SC2	Approved	Irinotecan affects the expression of MICOS complex subunit MIC60 (IMMT).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of MICOS complex subunit MIC60 (IMMT).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of MICOS complex subunit MIC60 (IMMT).	[43]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of MICOS complex subunit MIC60 (IMMT).	[44]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of MICOS complex subunit MIC60 (IMMT).	[41]

References

• [1] Complex-I Alteration and Enhanced Mitochondrial Fusion Are Associated With Prostate Cancer Progression.J Cell Physiol. 2016 Jun;231(6):1364-74. doi: 10.1002/jcp.25240. Epub 2015 Nov 24.
• [2] Suppression of motor protein KIF3C expression inhibits tumor growth and metastasis in breast cancer by inhibiting TGF- signaling.Cancer Lett. 2015 Nov 1;368(1):105-114. doi: 10.1016/j.canlet.2015.07.037. Epub 2015 Aug 10.
• [3] Biallelic variants in KIF14 cause intellectual disability with microcephaly.Eur J Hum Genet. 2018 Mar;26(3):330-339. doi: 10.1038/s41431-017-0088-9. Epub 2018 Jan 17.
• [4] Potential Role of Mic60/Mitofilin in Parkinson's Disease.Front Neurosci. 2019 Jan 25;12:898. doi: 10.3389/fnins.2018.00898. eCollection 2018.
• [5] LMD proteomics provides evidence for hippocampus field-specific motor protein abundance changes with relevance to Alzheimer's disease.Biochim Biophys Acta Proteins Proteom. 2017 Jun;1865(6):703-714. doi: 10.1016/j.bbapap.2017.03.013. Epub 2017 Apr 2.
• [6] Anthrax: a motor protein determines anthrax susceptibility.Curr Biol. 2001 Nov 13;11(22):R905-6. doi: 10.1016/s0960-9822(01)00550-4.
• [7] Regulation and targeting of Eg5, a mitotic motor protein in blast crisis CML: overcoming imatinib resistance.Cell Cycle. 2006 Oct;5(19):2223-9. doi: 10.4161/cc.5.19.3255. Epub 2006 Oct 1.
• [8] The novel conserved mitochondrial inner-membrane protein MTGM regulates mitochondrial morphology and cell proliferation.J Cell Sci. 2009 Jul 1;122(Pt 13):2252-62. doi: 10.1242/jcs.038513.
• [9] The role of mitofilin in left ventricular hypertrophy in hemodialysis patients.Ren Fail. 2018 Nov;40(1):252-258. doi: 10.1080/0886022X.2018.1456455.
• [10] Altered myocyte contractility and calcium homeostasis in alpha-myosin heavy chain point mutations linked to familial dilated cardiomyopathy.Arch Biochem Biophys. 2017 Feb 1;615:53-60. doi: 10.1016/j.abb.2016.12.007. Epub 2017 Jan 11.
• [11] Changes in vimentin, lamin A/C and mitofilin induceaberrant cell organization in fibroblasts from Fanconi anemia complementation group A (FA-A) patients.Biochimie. 2013 Oct;95(10):1838-47. doi: 10.1016/j.biochi.2013.06.024. Epub 2013 Jul 2.
• [12] Time matters: Point of care screening and streamlined linkage to care dramatically improves hepatitis C treatment uptake in prisoners in England.Int J Drug Policy. 2020 Jan;75:102608. doi: 10.1016/j.drugpo.2019.102608. Epub 2019 Nov 20.
• [13] Early-Onset Hypertrophic Cardiomyopathy Mutations Significantly Increase the Velocity, Force, and Actin-Activated ATPase Activity of Human -Cardiac Myosin.Cell Rep. 2016 Dec 13;17(11):2857-2864. doi: 10.1016/j.celrep.2016.11.040.
• [14] A neurodegenerative perspective on mitochondrial optic neuropathies.Acta Neuropathol. 2016 Dec;132(6):789-806. doi: 10.1007/s00401-016-1625-2. Epub 2016 Sep 30.
• [15] Prognostic significance of IMMT expression in surgically-resected lung adenocarcinoma.Thorac Cancer. 2019 Nov;10(11):2142-2151. doi: 10.1111/1759-7714.13200. Epub 2019 Oct 3.
• [16] Reduced axonal motor protein expression in non-lesional grey matter in multiple sclerosis.Mult Scler. 2014 Jun;20(7):812-21. doi: 10.1177/1352458513508836. Epub 2013 Oct 21.
• [17] Modulation of Agrin and RhoA Pathways Ameliorates Movement Defects and Synapse Morphology in MYO9A-Depleted Zebrafish.Cells. 2019 Aug 7;8(8):848. doi: 10.3390/cells8080848.
• [18] Charcot-Marie-Tooth disease type 2A caused by mutation in a microtubule motor KIF1Bbeta. Cell. 2001 Jun 1;105(5):587-97. doi: 10.1016/s0092-8674(01)00363-4.
• [19] Respiratory syncytial virus co-opts host mitochondrial function to favour infectious virus production.Elife. 2019 Jun 27;8:e42448. doi: 10.7554/eLife.42448.
• [20] A Molecular Mechanism Underlying Genotype-Specific Intrahepatic Cholestasis Resulting From MYO5B Mutations.Hepatology. 2020 Jul;72(1):213-229. doi: 10.1002/hep.31002. Epub 2020 Apr 23.
• [21] De novo truncating mutation in Kinesin 17 associated with schizophrenia. Biol Psychiatry. 2010 Oct 1;68(7):649-56. doi: 10.1016/j.biopsych.2010.04.018. Epub 2010 Jun 19.
• [22] Human myosin VIIa is a very slow processive motor protein on various cellular actin structures.J Biol Chem. 2017 Jun 30;292(26):10950-10960. doi: 10.1074/jbc.M116.765966. Epub 2017 May 15.
• [23] Drosophila ADCK1 is critical for maintaining mitochondrial structures and functions in the muscle.PLoS Genet. 2019 May 24;15(5):e1008184. doi: 10.1371/journal.pgen.1008184. eCollection 2019 May.
• [24] Congenital microcephaly and chorioretinopathy due to de novo heterozygous KIF11 mutations: five novel mutations and review of the literature.Am J Med Genet A. 2014 Nov;164A(11):2879-86. doi: 10.1002/ajmg.a.36707. Epub 2014 Aug 12.
• [25] Hepatitis B virus upregulates the expression of kinesin family member 4A.Mol Med Rep. 2015 Sep;12(3):3503-3507. doi: 10.3892/mmr.2015.3792. Epub 2015 May 15.
• [26] Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries.Int J Cancer. 2003 Aug 20;106(2):244-51. doi: 10.1002/ijc.11208.
• [27] The motor protein kinesin-1 links neurofibromin and merlin in a common cellular pathway of neurofibromatosis.J Biol Chem. 2002 Oct 4;277(40):36909-12. doi: 10.1074/jbc.C200434200. Epub 2002 Aug 20.
• [28] Human deafness mutation E385D disrupts the mechanochemical coupling and subcellular targeting of myosin-1a.Biophys J. 2008 Jan 15;94(2):L5-7. doi: 10.1529/biophysj.107.122689. Epub 2007 Nov 2.
• [29] Hypertension-associated kidney disease: perhaps no more.J Am Soc Nephrol. 2008 Nov;19(11):2047-51. doi: 10.1681/ASN.2008060621. Epub 2008 Oct 15.
• [30] Deciphering the super relaxed state of human -cardiac myosin and the mode of action of mavacamten from myosin molecules to muscle fibers.Proc Natl Acad Sci U S A. 2018 Aug 28;115(35):E8143-E8152. doi: 10.1073/pnas.1809540115. Epub 2018 Aug 13.
• [31] Association network analysis identifies enzymatic components of gut microbiota that significantly differ between colorectal cancer patients and healthy controls.PeerJ. 2019 Jul 29;7:e7315. doi: 10.7717/peerj.7315. eCollection 2019.
• [32] Theoretical Investigations of the Role of Mutations in Dynamics of Kinesin Motor Proteins.J Phys Chem B. 2018 May 3;122(17):4653-4661. doi: 10.1021/acs.jpcb.8b00830. Epub 2018 Apr 23.
• [33] Mice lacking myosin IXb, an inflammatory bowel disease susceptibility gene, have impaired intestinal barrier function and superficial ulceration in the ileum.Cytoskeleton (Hoboken). 2016 Apr;73(4):163-79. doi: 10.1002/cm.21292. Epub 2016 Apr 4.
• [34] MiRNA-335 suppresses neuroblastoma cell invasiveness by direct targeting of multiple genes from the non-canonical TGF- signalling pathway.Carcinogenesis. 2012 May;33(5):976-85. doi: 10.1093/carcin/bgs114. Epub 2012 Mar 1.
• [35] Mitochondrial dysregulation of osteoarthritic human articular chondrocytes analyzed by proteomics: a decrease in mitochondrial superoxide dismutase points to a redox imbalance.Mol Cell Proteomics. 2009 Jan;8(1):172-89. doi: 10.1074/mcp.M800292-MCP200. Epub 2008 Sep 9.
• [36] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Identification of biomarkers for the initiation of apoptosis in human preneoplastic colonocytes by proteome analysis. Int J Cancer. 2004 Mar 20;109(2):220-9. doi: 10.1002/ijc.11692.
• [40] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [41] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [42] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [43] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [44] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.