Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE9QDV6)

• DOT Name: Filaggrin (FLG)
• Gene Name: FLG
• Related Disease:
  Autosomal dominant ichthyosis vulgaris
  Advanced cancer
  Allergic asthma
  Allergic contact dermatitis
  Alopecia
  Alopecia areata
  Alzheimer disease
  Alzheimer disease 3
  Autism
  Autoimmune disease
  Breast cancer
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Contact dermatitis
  Dermatitis
  Eosinophilic esophagitis
  Glioma
  Human papillomavirus infection
  Inflammatory bowel disease
  Irritant contact dermatitis
  Keratosis pilaris
  Lichen planus
  Neoplasm
  Oral lichen planus
  Osteoarthritis
  Promyelocytic leukaemia
  Psoriatic arthritis
  Recessive X-linked ichthyosis
  Rheumatoid arthritis
  Rhinitis
  Sarcoidosis
  Skin and skin-structure infection
  Skin disease
  Sleep disorder
  Small lymphocytic lymphoma
  Type-1/2 diabetes
  Congenital ichthyosiform erythroderma
  Movement disorder
  Squamous cell carcinoma
  Graft-versus-host disease
  Granular corneal dystrophy type II
  Impulse control disorder
  Melanoma
  Primary cutaneous T-cell lymphoma
• UniProt ID: FILA_HUMAN
• PDB ID: 4PCW
• Pfam ID: PF03516 ; PF01023
• Sequence:
  MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDH
  LDIDHNKKIDFTEFLLMVFKLAQAYYESTRKENLPISGHKHRKHSHHDKHEDNKQEENKE
  NRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNS
  SKKEKNKTENTRLGDNRKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQ
  DEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESRTRKRRGSRVSQD
  RDSEGHSEDSERHSGSASRNHHGSAWEQSRDGSRHPRSHDEDRASHGHSADSSRQSGTRH
  AETSSRGQTASSHEQARSSPGERHGSGHQQSADSSRHSATGRGQASSAVSDRGHRGSSGS
  QASDSEGHSENSDTQSVSGHGKAGLRQQSHQESTRGRSGERSGRSGSSLYQVSTHEQPDS
  AHGRTGTSTGGRQGSHHEQARDSSRHSASQEGQDTIRGHPGSSRGGRQGSHHEQSVNRSG
  HSGSHHSHTTSQGRSDASHGQSGSRSASRQTRNEEQSGDGTRHSGSRHHEASSQADSSRH
  SQVGQGQSSGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHHGSAQEQSRDGSRHP
  RSHHEDRAGHGHSADSSRKSGTRHTQNSSSGQAASSHEQARSSAGERHGSRHQLQSADSS
  RHSGTGHGQASSAVRDSGHRGSSGSQATDSEGHSEDSDTQSVSGHGQAGHHQQSHQESAR
  DRSGERSRRSGSFLYQVSTHKQSESSHGWTGPSTGVRQGSHHEQARDNSRHSASQDGQDT
  IRGHPGSSRRGRQGSHHEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEE
  QSRDGSRHSGSRHHEASSHADISRHSQAGQGQSEGSRTSRRQGSSVSQDSDSEGHSEDSE
  RWSGSASRNHRGSAQEQSRHGSRHPRSHHEDRAGHGHSADSSRQSGTPHAETSSGGQAAS
  SHEQARSSPGERHGSRHQQSADSSRHSGIPRRQASSAVRDSGHWGSSGSQASDSEGHSEE
  SDTQSVSGHGQDGPHQQSHQESARDWSGGRSGRSGSFIYQVSTHEQSESAHGRTRTSTGR
  RQGSHHEQARDSSRHSASQEGQDTIRAHPGSRRGGRQGSHHEQSVDRSGHSGSHHSHTTS
  QGRSDASHGQSGSRSASRQTRKDKQSGDGSRHSGSRHHEAASWADSSRHSQVGQEQSSGS
  RTSRHQGSSVSQDSDSERHSDDSERLSGSASRNHHGSSREQSRDGSRHPGFHQEDRASHG
  HSADSSRQSGTHHTESSSHGQAVSSHEQARSSPGERHGSRHQQSADSSRHSGIGHRQASS
  AVRDSGHRGSSGSQVTNSEGHSEDSDTQSVSAHGQAGPHQQSHKESARGQSGESSGRSRS
  FLYQVSSHEQSESTHGQTAPSTGGRQGSRHEQARNSSRHSASQDGQDTIRGHPGSSRGGR
  QGSYHEQSVDRSGHSGYHHSHTTPQGRSDASHGQSGPRSASRQTRNEEQSGDGSRHSGSR
  HHEPSTRAGSSRHSQVGQGESAGSKTSRRQGSSVSQDRDSEGHSEDSERRSESASRNHYG
  SAREQSRHGSRNPRSHQEDRASHGHSAESSRQSGTRHAETSSGGQAASSQEQARSSPGER
  HGSRHQQSADSSTDSGTGRRQDSSVVGDSGNRGSSGSQASDSEGHSEESDTQSVSAHGQA
  GPHQQSHQESTRGQSGERSGRSGSFLYQVSTHEQSESAHGRTGPSTGGRQRSRHEQARDS
  SRHSASQEGQDTIRGHPGSSRGGRQGSHYEQSVDSSGHSGSHHSHTTSQERSDVSRGQSG
  SRSVSRQTRNEKQSGDGSRHSGSRHHEASSRADSSRHSQVGQGQSSGPRTSRNQGSSVSQ
  DSDSQGHSEDSERWSGSASRNHLGSAWEQSRDGSRHPGSHHEDRAGHGHSADSSRQSGTR
  HTESSSRGQAASSHEQARSSAGERHGSHHQLQSADSSRHSGIGHGQASSAVRDSGHRGYS
  GSQASDSEGHSEDSDTQSVSAQGKAGPHQQSHKESARGQSGESSGRSGSFLYQVSTHEQS
  ESTHGQSAPSTGGRQGSHYDQAQDSSRHSASQEGQDTIRGHPGPSRGGRQGSHQEQSVDR
  SGHSGSHHSHTTSQGRSDASRGQSGSRSASRKTYDKEQSGDGSRHSGSHHHEASSWADSS
  RHSLVGQGQSSGPRTSRPRGSSVSQDSDSEGHSEDSERRSGSASRNHHGSAQEQSRDGSR
  HPRSHHEDRAGHGHSAESSRQSGTHHAENSSGGQAASSHEQARSSAGERHGSHHQQSADS
  SRHSGIGHGQASSAVRDSGHRGSSGSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQEST
  RGRSAGRSGRSGSFLYQVSTHEQSESAHGRTGTSTGGRQGSHHKQARDSSRHSTSQEGQD
  TIHGHPGSSSGGRQGSHYEQLVDRSGHSGSHHSHTTSQGRSDASHGHSGSRSASRQTRND
  EQSGDGSRHSGSRHHEASSRADSSGHSQVGQGQSEGPRTSRNWGSSFSQDSDSQGHSEDS
  ERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGHGHSADSSRQSGTRHTQTSSGGQAA
  SSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGYSGSQASDNEGHSE
  DSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSGSFLYQVSTHEQSESSHGWTGPSTR
  GRQGSRHEQAQDSSRHSASQDGQDTIRGHPGSSRGGRQGYHHEHSVDSSGHSGSHHSHTT
  SQGRSDASRGQSGSRSASRTTRNEEQSGDGSRHSGSRHHEASTHADISRHSQAVQGQSEG
  SRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGH
  GHSADSSRQSGTRHTQTSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQAS
  SAVRDSGHRGYSGSQASDNEGHSEDSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSG
  SFLYQVSTHEQSESSHGWTGPSTRGRQGSRHEQAQDSSRHSASQYGQDTIRGHPGSSRGG
  RQGYHHEHSVDSSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEEQSGDSSRHSVS
  RHHEASTHADISRHSQAVQGQSEGSRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHR
  GSVQEQSRHGSRHPRSHHEDRAGHGHSADRSRQSGTRHAETSSGGQAASSHEQARSSPGE
  RHGSRHQQSADSSRHSGIPRGQASSAVRDSRHWGSSGSQASDSEGHSEESDTQSVSGHGQ
  AGPHQQSHQESARDRSGGRSGRSGSFLYQVSTHEQSESAHGRTRTSTGRRQGSHHEQARD
  SSRHSASQEGQDTIRGHPGSSRRGRQGSHYEQSVDRSGHSGSHHSHTTSQGRSDASRGQS
  GSRSASRQTRNDEQSGDGSRHSWSHHHEASTQADSSRHSQSGQGQSAGPRTSRNQGSSVS
  QDSDSQGHSEDSERWSGSASRNHRGSAQEQSRDGSRHPTSHHEDRAGHGHSAESSRQSGT
  HHAENSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGSS
  GSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQESTRGRSAGRSGRSGSFLYQVSTHEQS
  ESAHGRAGPSTGGRQGSRHEQARDSSRHSASQEGQDTIRGHPGSRRGGRQGSYHEQSVDR
  SGHSGSHHSHTTSQGRSDASHGQSGSRSASRETRNEEQSGDGSRHSGSRHHEASTQADSS
  RHSQSGQGESAGSRRSRRQGSSVSQDSDSEAYPEDSERRSESASRNHHGSSREQSRDGSR
  HPGSSHRDTASHVQSSPVQSDSSTAKEHGHFSSLSQDSAYHSGIQSRGSPHSSSSYHYQS
  EGTERQKGQSGLVWRHGSYGSADYDYGESGFRHSQHGSVSYNSNPVVFKERSDICKASAF
  GKDHPRYYATYINKDPGLCGHSSDISKQLGFSQSQRYYYYE
• Function: Aggregates keratin intermediate filaments and promotes disulfide-bond formation among the intermediate filaments during terminal differentiation of mammalian epidermis.
• Tissue Specificity: Expressed in skin, thymus, stomach, tonsils, testis, placenta, kidney, pancreas, mammary gland, bladder, thyroid, salivary gland and trachea, but not detected in heart, brain, liver, lung, bone marrow, small intestine, spleen, prostate, colon, or adrenal gland . In the skin, mainly expressed in stratum granulosum of the epidermis .
• Reactome Pathway: Formation of the cornified envelope (R-HSA-6809371)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autosomal dominant ichthyosis vulgaris	DISHKOLS	Definitive	Semidominant	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Allergic asthma	DISHF0H3	Strong	Genetic Variation	[3]
Allergic contact dermatitis	DISFFVF9	Strong	Biomarker	[4]
Alopecia	DIS37HU4	Strong	Genetic Variation	[5]
Alopecia areata	DIS0XXBJ	Strong	Genetic Variation	[5]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[6]
Alzheimer disease 3	DISVT69G	Strong	Genetic Variation	[6]
Autism	DISV4V1Z	Strong	CausalMutation	[7]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Cervical cancer	DISFSHPF	Strong	Genetic Variation	[10]
Cervical carcinoma	DIST4S00	Strong	Genetic Variation	[10]
Contact dermatitis	DISQ3AU0	Strong	Genetic Variation	[11]
Dermatitis	DISY5SZC	Strong	Genetic Variation	[12]
Eosinophilic esophagitis	DISR8WSB	Strong	Altered Expression	[13]
Glioma	DIS5RPEH	Strong	Genetic Variation	[14]
Human papillomavirus infection	DISX61LX	Strong	Genetic Variation	[10]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[15]
Irritant contact dermatitis	DIS62JY3	Strong	Genetic Variation	[16]
Keratosis pilaris	DISKOBPU	Strong	Genetic Variation	[17]
Lichen planus	DISRPMMS	Strong	Altered Expression	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Oral lichen planus	DISVEAJA	Strong	Biomarker	[20]
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[21]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[22]
Psoriatic arthritis	DISLWTG2	Strong	Genetic Variation	[23]
Recessive X-linked ichthyosis	DISZY56W	Strong	Biomarker	[24]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[25]
Rhinitis	DISKLMN7	Strong	Genetic Variation	[26]
Sarcoidosis	DISE5B8Z	Strong	Biomarker	[27]
Skin and skin-structure infection	DIS3F9EY	Strong	Genetic Variation	[28]
Skin disease	DISDW8R6	Strong	Altered Expression	[29]
Sleep disorder	DIS3JP1U	Strong	Genetic Variation	[30]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[31]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[4]
Congenital ichthyosiform erythroderma	DISV8HQX	moderate	Biomarker	[32]
Movement disorder	DISOJJ2D	moderate	CausalMutation	[33]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[34]
Graft-versus-host disease	DIS0QADF	Limited	Altered Expression	[18]
Granular corneal dystrophy type II	DISAEE20	Limited	Altered Expression	[35]
Impulse control disorder	DISRIYJ5	Limited	Genetic Variation	[16]
Melanoma	DIS1RRCY	Limited	Biomarker	[36]
Primary cutaneous T-cell lymphoma	DIS35WVW	Limited	Altered Expression	[37]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Filaggrin (FLG) affects the response to substance of Bisphenol A.	[49]
OXYBENZONE	DMMZYX6	Investigative	Filaggrin (FLG) affects the response to substance of OXYBENZONE.	[49]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Filaggrin (FLG).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Filaggrin (FLG).	[39]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Filaggrin (FLG).	[40]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Filaggrin (FLG).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Filaggrin (FLG).	[42]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Filaggrin (FLG).	[43]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Filaggrin (FLG).	[38]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Filaggrin (FLG).	[44]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Filaggrin (FLG).	[44]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Filaggrin (FLG).	[38]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Filaggrin (FLG).	[45]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of Filaggrin (FLG).	[46]
Calcipotriol	DM03CP7	Approved	Calcipotriol decreases the expression of Filaggrin (FLG).	[42]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN increases the expression of Filaggrin (FLG).	[48]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Filaggrin (FLG).	[38]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Filaggrin (FLG).	[47]

References

• [1] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [2] Genetic variants of filaggrin are associated with occupational dermal exposure and blood DNA alterations in hairdressers.Sci Total Environ. 2019 Feb 25;653:45-54. doi: 10.1016/j.scitotenv.2018.10.328. Epub 2018 Oct 27.
• [3] One remarkable molecule: filaggrin.J Invest Dermatol. 2012 Mar;132(3 Pt 2):751-62. doi: 10.1038/jid.2011.393. Epub 2011 Dec 8.
• [4] Filaggrin and atopic march.Biochem Med (Zagreb). 2019 Jun 15;29(2):020501. doi: 10.11613/BM.2019.020501.
• [5] Increased pachyonychia congenita severity in patients with concurrent keratin and filaggrin mutations.Br J Dermatol. 2009 Dec;161(6):1391-5. doi: 10.1111/j.1365-2133.2009.09471.x. Epub 2009 Sep 28.
• [6] The Value of FLG Null Mutations in Predicting Treatment Response in Atopic Dermatitis: An Observational Study in Finnish Patients.Acta Derm Venereol. 2017 Apr 6;97(4):456-463. doi: 10.2340/00015555-2578.
• [7] Loss-of-function mutations in the gene encoding filaggrin cause ichthyosis vulgaris. Nat Genet. 2006 Mar;38(3):337-42. doi: 10.1038/ng1743. Epub 2006 Jan 29.
• [8] Loss-of-function mutations in the filaggrin gene: no contribution to disease susceptibility, but to autoantibody formation against citrullinated peptides in early rheumatoid arthritis.Ann Rheum Dis. 2008 Jan;67(1):131-3. doi: 10.1136/ard.2007.073239. Epub 2007 Aug 17.
• [9] BEK and FLG, two receptors to members of the FGF family, are amplified in subsets of human breast cancers.Oncogene. 1991 Apr;6(4):659-63.
• [10] Common filaggrin gene mutations and risk of cervical cancer.Acta Oncol. 2015 Feb;54(2):217-23. doi: 10.3109/0284186X.2014.973613. Epub 2014 Nov 10.
• [11] Contact Allergy in Children with Atopic Dermatitis: A Retrospective Study.Endocr Metab Immune Disord Drug Targets. 2019;19(7):1083-1087. doi: 10.2174/1871530319666190211123342.
• [12] Spontaneous atopic dermatitis in mice with a defective skin barrier is independent of ILC2 and mediated by IL-1.Allergy. 2019 Oct;74(10):1920-1933. doi: 10.1111/all.13801. Epub 2019 Apr 29.
• [13] Evidence of an abnormal epithelial barrier in active, untreated and corticosteroid-treated eosinophilic esophagitis.Allergy. 2018 Jan;73(1):239-247. doi: 10.1111/all.13244. Epub 2017 Aug 6.
• [14] Epidemiology of human atopic dermatitis--seven areas of notable progress and seven areas of notable ignorance.Vet Dermatol. 2013 Feb;24(1):3-9.e1-2. doi: 10.1111/j.1365-3164.2012.01079.x.
• [15] Filaggrin loss-of-function variants are associated with atopic comorbidity in pediatric inflammatory bowel disease.Inflamm Bowel Dis. 2009 Oct;15(10):1492-8. doi: 10.1002/ibd.20926.
• [16] Impact of atopic dermatitis and loss-of-function mutations in the filaggrin gene on the development of occupational irritant contact dermatitis.Br J Dermatol. 2013 Feb;168(2):326-332. doi: 10.1111/bjd.12083.
• [17] Sebaceous gland, hair shaft, and epidermal barrier abnormalities in keratosis pilaris with and without filaggrin deficiency.Am J Pathol. 2015 Apr;185(4):1012-21. doi: 10.1016/j.ajpath.2014.12.012. Epub 2015 Feb 7.
• [18] Increased regulatory T cells and eosinophils characterize atopic dermatitis-like graft-versus-host disease compared with lichen planus-like graft-versus-host disease.J Am Acad Dermatol. 2020 Sep;83(3):824-831. doi: 10.1016/j.jaad.2019.08.005. Epub 2019 Aug 9.
• [19] Tissue-engineered 3D melanoma model with blood and lymphatic capillaries for drug development.Sci Rep. 2018 Sep 4;8(1):13191. doi: 10.1038/s41598-018-31502-6.
• [20] Filaggrin gene mutations and the distribution of filaggrin in oral mucosa of patients with oral lichen planus and healthy controls.J Eur Acad Dermatol Venereol. 2017 May;31(5):887-893. doi: 10.1111/jdv.14098. Epub 2017 Jan 9.
• [21] Association between loss-of-function mutations in the filaggrin gene and self-reported food allergy and alcohol sensitivity.Int Arch Allergy Immunol. 2013;161(3):234-42. doi: 10.1159/000345949. Epub 2013 Mar 15.
• [22] Toward Candidate Proteomic Biomarkers in Clinical Monitoring of Acute Promyelocytic Leukemia Treatment with Arsenic Trioxide.OMICS. 2019 Feb;23(2):119-130. doi: 10.1089/omi.2018.0178.
• [23] Loss-of-function variants of the filaggrin gene are not major susceptibility factors for psoriasis vulgaris or psoriatic arthritis in German patients.J Invest Dermatol. 2007 Jun;127(6):1367-70. doi: 10.1038/sj.jid.5700720. Epub 2007 Jan 25.
• [24] Exacerbation of ichthyosis vulgaris phenotype by co-inheritance of STS and FLG mutations in a Chinese family with ichthyosis: a case report.BMC Med Genet. 2018 Jul 18;19(1):120. doi: 10.1186/s12881-018-0642-5.
• [25] The role of synthetic manufactured peptides containing common citrullinated epitopes in rheumatoid arthritis diagnosis.Clin Immunol. 2019 Feb;199:7-11. doi: 10.1016/j.clim.2018.12.004. Epub 2018 Dec 10.
• [26] Differential associations of allergic disease genetic variants with developmental profiles of eczema, wheeze and rhinitis.Clin Exp Allergy. 2019 Nov;49(11):1475-1486. doi: 10.1111/cea.13485. Epub 2019 Oct 15.
• [27] Genetic Association Analysis Reveals Differences in the Contribution of NOD2 Variants to the Clinical Phenotypes of Orofacial Granulomatosis.Inflamm Bowel Dis. 2016 Jul;22(7):1552-8. doi: 10.1097/MIB.0000000000000844.
• [28] Cutaneous Deficiency of Filaggrin and STAT3 Exacerbates Vaccinia Disease In Vivo.PLoS One. 2017 Jan 12;12(1):e0170070. doi: 10.1371/journal.pone.0170070. eCollection 2017.
• [29] LPA Induces Keratinocyte Differentiation and Promotes Skin Barrier Function through the LPAR1/LPAR5-RHO-ROCK-SRF Axis.J Invest Dermatol. 2019 May;139(5):1010-1022. doi: 10.1016/j.jid.2018.10.034. Epub 2018 Nov 14.
• [30] Prognosis of Preschool Eczema and Factors of Importance for Remission.Acta Derm Venereol. 2018 Jul 11;98(7):630-635. doi: 10.2340/00015555-2919.
• [31] Characterization of sunburn cells after exposure to ultraviolet light.Photodermatol Photoimmunol Photomed. 1995 Aug;11(4):149-54. doi: 10.1111/j.1600-0781.1995.tb00157.x.
• [32] Distinguishing ichthyoses by protein profiling.PLoS One. 2013 Oct 9;8(10):e75355. doi: 10.1371/journal.pone.0075355. eCollection 2013.
• [33] Coexpression networks implicate human midfetal deep cortical projection neurons in the pathogenesis of autism.Cell. 2013 Nov 21;155(5):997-1007. doi: 10.1016/j.cell.2013.10.020.
• [34] Upregulation of lipocalin-2 in human papillomavirus-positive keratinocytes and cutaneous squamous cell carcinomas.J Gen Virol. 2011 Feb;92(Pt 2):395-401. doi: 10.1099/vir.0.025064-0. Epub 2010 Nov 3.
• [35] Skin barrier damage after exposure to paraphenylenediamine.J Allergy Clin Immunol. 2020 Feb;145(2):619-631.e2. doi: 10.1016/j.jaci.2019.11.023. Epub 2019 Nov 26.
• [36] The Barrier Molecules Junction Plakoglobin, Filaggrin, and Dystonin Play Roles in Melanoma Growth and Angiogenesis.Ann Surg. 2019 Oct;270(4):712-722. doi: 10.1097/SLA.0000000000003522.
• [37] Skin barrier dysfunction and low antimicrobial peptide expression in cutaneous T-cell lymphoma.Clin Cancer Res. 2014 Aug 15;20(16):4339-48. doi: 10.1158/1078-0432.CCR-14-0077. Epub 2014 Jun 11.
• [38] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [39] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [40] Effects of low-dose Bisphenol A on calcium ion influx and on genes of proliferation and differentiation in immortalized human gingival cells in vitro: The role of estrogen receptor beta. Dent Mater. 2017 Sep;33(9):1021-1032. doi: 10.1016/j.dental.2017.06.011. Epub 2017 Jul 9.
• [41] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [42] Effects of 1 alpha,25-dihydroxy-vitamin D3 and calcipotriol on organotypic cultures of outer root sheath cells: a potential model to evaluate antipsoriatic drugs. Arch Dermatol Res. 1993;285(7):402-9. doi: 10.1007/BF00372133.
• [43] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [44] Retinoic acid and hydroquinone induce inverse expression patterns on cornified envelope-associated proteins: implication in skin irritation. J Dermatol Sci. 2014 Nov;76(2):112-9. doi: 10.1016/j.jdermsci.2014.08.003. Epub 2014 Aug 26.
• [45] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [46] Deducing signaling pathways from parallel actions of arsenite and antimonite in human epidermal keratinocytes. Sci Rep. 2020 Feb 19;10(1):2890. doi: 10.1038/s41598-020-59577-0.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [49] Urinary excretion of phenols, parabens and benzophenones in young men: Associations to reproductive hormones and semen quality are modified by mutations in the Filaggrin gene. Environ Int. 2018 Dec;121(Pt 1):365-374. doi: 10.1016/j.envint.2018.09.020. Epub 2018 Sep 20.