Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEITRP4)

DOT Name Olfactory receptor 2AG1 (OR2AG1)
Synonyms HT3; Olfactory receptor 2AG3; Olfactory receptor OR11-79
Gene Name OR2AG1
Related Disease
Cerebral infarction ( )
Drug dependence ( )
Advanced cancer ( )
Alzheimer disease ( )
Anorexia nervosa cachexia ( )
Anxiety ( )
Anxiety disorder ( )
Carcinoma of esophagus ( )
Cardiac arrest ( )
Cervical carcinoma ( )
Constipation ( )
Epilepsy ( )
Esophageal cancer ( )
Glioma ( )
Graves disease ( )
Head-neck squamous cell carcinoma ( )
Leukopenia ( )
Liver cirrhosis ( )
Lung cancer ( )
Lung carcinoma ( )
Mental disorder ( )
Neoplasm ( )
Neoplasm of esophagus ( )
Nicotine dependence ( )
Obsessive compulsive disorder ( )
Osteoporosis ( )
Polycystic ovarian syndrome ( )
Psoriasis ( )
Schizophrenia ( )
Systemic lupus erythematosus ( )
Thrombocytopenia ( )
Adenocarcinoma ( )
Alcohol dependence ( )
Ataxia-telangiectasia ( )
Breast cancer ( )
Breast carcinoma ( )
Cognitive impairment ( )
Migraine disorder ( )
Ankylosing spondylitis ( )
Arthritis ( )
Cataract ( )
Cervical cancer ( )
Depression ( )
Human papillomavirus infection ( )
Inflammatory bowel disease ( )
Irritable bowel syndrome ( )
Nervous system disease ( )
Rheumatoid arthritis ( )
UniProt ID
O2AG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13853
Sequence
MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMY
LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY
DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE
IPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT
CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA
LRRVLGKYMLPAHSTL
Function Odorant receptor.
KEGG Pathway
Olfactory transduction (hsa04740 )
Reactome Pathway
Expression and translocation of olfactory receptors (R-HSA-9752946 )

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cerebral infarction DISR1WNP Definitive Biomarker [1]
Drug dependence DIS9IXRC Definitive Biomarker [2]
Advanced cancer DISAT1Z9 Strong Biomarker [3]
Alzheimer disease DISF8S70 Strong Genetic Variation [4]
Anorexia nervosa cachexia DISFO5RQ Strong Genetic Variation [5]
Anxiety DISIJDBA Strong Genetic Variation [6]
Anxiety disorder DISBI2BT Strong Genetic Variation [6]
Carcinoma of esophagus DISS6G4D Strong Biomarker [7]
Cardiac arrest DIS9DIA4 Strong Genetic Variation [8]
Cervical carcinoma DIST4S00 Strong Biomarker [9]
Constipation DISRQXWI Strong Genetic Variation [10]
Epilepsy DISBB28L Strong Altered Expression [11]
Esophageal cancer DISGB2VN Strong Biomarker [7]
Glioma DIS5RPEH Strong Biomarker [12]
Graves disease DISU4KOQ Strong Genetic Variation [13]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [14]
Leukopenia DISJMBMM Strong Biomarker [15]
Liver cirrhosis DIS4G1GX Strong Genetic Variation [16]
Lung cancer DISCM4YA Strong Genetic Variation [17]
Lung carcinoma DISTR26C Strong Genetic Variation [17]
Mental disorder DIS3J5R8 Strong Biomarker [18]
Neoplasm DISZKGEW Strong Biomarker [12]
Neoplasm of esophagus DISOLKAQ Strong Biomarker [7]
Nicotine dependence DISZD9W7 Strong Genetic Variation [19]
Obsessive compulsive disorder DIS1ZMM2 Strong Biomarker [20]
Osteoporosis DISF2JE0 Strong Biomarker [21]
Polycystic ovarian syndrome DISZ2BNG Strong Genetic Variation [22]
Psoriasis DIS59VMN Strong Genetic Variation [23]
Schizophrenia DISSRV2N Strong Biomarker [24]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [25]
Thrombocytopenia DISU61YW Strong Biomarker [15]
Adenocarcinoma DIS3IHTY moderate Biomarker [26]
Alcohol dependence DIS4ZSCO moderate Biomarker [27]
Ataxia-telangiectasia DISP3EVR moderate Genetic Variation [28]
Breast cancer DIS7DPX1 moderate Biomarker [29]
Breast carcinoma DIS2UE88 moderate Biomarker [29]
Cognitive impairment DISH2ERD Disputed Biomarker [30]
Migraine disorder DISFCQTG Disputed Biomarker [31]
Ankylosing spondylitis DISRC6IR Limited Genetic Variation [32]
Arthritis DIST1YEL Limited Biomarker [33]
Cataract DISUD7SL Limited Genetic Variation [34]
Cervical cancer DISFSHPF Limited Altered Expression [35]
Depression DIS3XJ69 Limited Genetic Variation [6]
Human papillomavirus infection DISX61LX Limited Biomarker [36]
Inflammatory bowel disease DISGN23E Limited Altered Expression [3]
Irritable bowel syndrome DIS27206 Limited Altered Expression [37]
Nervous system disease DISJ7GGT Limited Biomarker [38]
Rheumatoid arthritis DISTSB4J Limited Genetic Variation [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Olfactory receptor 2AG1 (OR2AG1). [40]
------------------------------------------------------------------------------------

References

1 Association of polymorphisms in thromboxane A2 receptor and thromboxane A synthase 1 with cerebral infarction in a Korean population.BMB Rep. 2009 Apr 30;42(4):200-5. doi: 10.5483/bmbrep.2009.42.4.200.
2 Functional genetic variants that increase synaptic serotonin and 5-HT3 receptor sensitivity predict alcohol and drug dependence.Mol Psychiatry. 2011 Nov;16(11):1139-46. doi: 10.1038/mp.2010.94. Epub 2010 Sep 14.
3 Tropisetron suppresses colitis-associated cancer in a mouse model in the remission stage.Int Immunopharmacol. 2016 Jul;36:9-16. doi: 10.1016/j.intimp.2016.04.014. Epub 2016 Apr 19.
4 Evaluation of the poly(ADP-ribose) polymerase-1 gene variants in Alzheimer's disease.J Clin Lab Anal. 2010;24(3):182-6. doi: 10.1002/jcla.20379.
5 Functional variants of the serotonin receptor type 3A and B gene are associated with eating disorders.Pharmacogenet Genomics. 2009 Oct;19(10):790-9. doi: 10.1097/FPC.0b013e32833132b3.
6 Serotonin receptor 3A polymorphism c.-42C > T is associated with severe dyspepsia.BMC Med Genet. 2011 Oct 20;12:140. doi: 10.1186/1471-2350-12-140.
7 Increasing Radiation Dose to the Thoracic Marrow Is Associated With Acute Hematologic Toxicities in Patients Receiving Chemoradiation for Esophageal Cancer.Front Oncol. 2019 Mar 15;9:147. doi: 10.3389/fonc.2019.00147. eCollection 2019.
8 Mild hypothermia attenuates post-resuscitation brain injury through a V-ATPase mechanism in a rat model of cardiac arrest.Genet Mol Res. 2016 Jun 3;15(2). doi: 10.4238/gmr.15027729.
9 LncRNA-CTS promotes metastasis and epithelial-to-mesenchymal transition through regulating miR-505/ZEB2 axis in cervical cancer.Cancer Lett. 2019 Nov 28;465:105-117. doi: 10.1016/j.canlet.2019.09.002. Epub 2019 Sep 6.
10 Efficacy and safety of 5-hydroxytryptamine 3 receptor antagonists in irritable bowel syndrome: A systematic review and meta-analysis of randomized controlled trials.PLoS One. 2017 Mar 14;12(3):e0172846. doi: 10.1371/journal.pone.0172846. eCollection 2017.
11 5-HT3 Receptors: A Potential Therapeutic Target for Epilepsy.Curr Neuropharmacol. 2018;16(1):29-36. doi: 10.2174/1570159X15666170508170412.
12 PEGylated peptide to TIP1 is a novel targeting agent that binds specifically to various cancers in vivo.J Control Release. 2019 Mar 28;298:194-201. doi: 10.1016/j.jconrel.2019.02.008. Epub 2019 Feb 11.
13 Thymic stromal lymphopoietin gene promoter polymorphisms and expression levels in Graves' disease and Graves' ophthalmopathy.BMC Med Genet. 2012 Nov 30;13:116. doi: 10.1186/1471-2350-13-116.
14 Cox-2 and IL-10 polymorphisms and association with squamous cell carcinoma of the head and neck in a Korean sample.J Korean Med Sci. 2010 Jul;25(7):1024-8. doi: 10.3346/jkms.2010.25.7.1024. Epub 2010 Jun 17.
15 Impact of Chemotherapy Regimens on Normal Tissue Complication Probability Models of Acute Hematologic Toxicity in Rectal Cancer Patients Receiving Intensity Modulated Radiation Therapy With Concurrent Chemotherapy From a Prospective Phase III Clinical Trial.Front Oncol. 2019 Apr 9;9:244. doi: 10.3389/fonc.2019.00244. eCollection 2019.
16 Incidence of Hepatitis B Virus Reactivation and Hepatotoxicity in Patients Receiving Long-term Treatment With Tumor Necrosis Factor Antagonists.Clin Gastroenterol Hepatol. 2018 Dec;16(12):1964-1973.e1. doi: 10.1016/j.cgh.2018.04.033. Epub 2018 Apr 24.
17 Anti-Tumor Potential of a 5-HT3 Receptor Antagonist as a Novel Autophagy Inducer in Lung Cancer: A Retrospective Clinical Study with In Vitro Confirmation.J Clin Med. 2019 Sep 3;8(9):1380. doi: 10.3390/jcm8091380.
18 Do polymorphisms in the human 5-HT3 genes contribute to pathological phenotypes?.Biochem Soc Trans. 2006 Nov;34(Pt 5):872-6. doi: 10.1042/BST0340872.
19 Association and interaction analyses of 5-HT3 receptor and serotonin transporter genes with alcohol, cocaine, and nicotine dependence using the SAGE data.Hum Genet. 2014 Jul;133(7):905-18. doi: 10.1007/s00439-014-1431-7. Epub 2014 Mar 4.
20 5-HT3 receptor influences the washing phenotype and visual organization in obsessive-compulsive disorder supporting 5-HT3 receptor antagonists as novel treatment option.Eur Neuropsychopharmacol. 2014 Jan;24(1):86-94. doi: 10.1016/j.euroneuro.2013.07.003. Epub 2013 Aug 6.
21 Association of KIT gene polymorphisms with bone mineral density in postmenopausal Korean women.J Hum Genet. 2007;52(6):502-509. doi: 10.1007/s10038-007-0143-4. Epub 2007 May 9.
22 Association study for single nucleotide polymorphisms in the CYP17A1 gene and polycystic ovary syndrome.Int J Mol Med. 2008 Aug;22(2):249-54.
23 Polymorphisms in the interleukin-20 gene: relationships to plaque-type psoriasis.Genes Immun. 2004 Mar;5(2):117-21. doi: 10.1038/sj.gene.6364046.
24 Adjunctive ondansetron for schizophrenia: A systematic review and meta-analysis of randomized controlled trials.J Psychiatr Res. 2019 Jun;113:27-33. doi: 10.1016/j.jpsychires.2019.02.024. Epub 2019 Mar 5.
25 The NBS1 genetic polymorphisms and the risk of the systemic lupus erythematosus in Taiwanese patients.J Clin Immunol. 2010 Sep;30(5):643-8. doi: 10.1007/s10875-010-9427-0. Epub 2010 Jun 23.
26 Reverse transcription-polymerase chain reaction and western blotting analysis for detection of p63 isoforms in uterine cervical cancers.Int J Gynecol Cancer. 2006 Jul-Aug;16(4):1643-7. doi: 10.1111/j.1525-1438.2006.00638.x.
27 Serotonin's Complex Role in Alcoholism: Implications for Treatment and Future Research.Alcohol Clin Exp Res. 2016 Jun;40(6):1192-201. doi: 10.1111/acer.13076. Epub 2016 May 10.
28 Possible association of SLC22A2 polymorphisms with aspirin-intolerant asthma. Int Arch Allergy Immunol. 2011;155(4):395-402. doi: 10.1159/000321267. Epub 2011 Feb 22.
29 Effective Antiemetic Therapy Is Important With Adjuvant Anthracycline-based Chemotherapy in Breast Cancer.Anticancer Res. 2019 Jan;39(1):279-283. doi: 10.21873/anticanres.13108.
30 Differences in 5-hydroxytryptamine-3B haplotype frequencies between Asians and Caucasians.Int J Biol Markers. 2012 Jan-Mar;27(1):34-8. doi: 10.5301/JBM.2011.8830.
31 Blockade of 5-HT3 receptors with granisetron does not affect trigeminothalamic nociceptive transmission in rats: Implication for migraine.Clin Exp Pharmacol Physiol. 2018 Jan;45(1):34-41. doi: 10.1111/1440-1681.12849. Epub 2017 Oct 4.
32 Association between the autophagy-related gene ULK1 and ankylosing spondylitis susceptibility in the Chinese Han population: a case-control study.Postgrad Med J. 2017 Dec;93(1106):752-757. doi: 10.1136/postgradmedj-2017-134964. Epub 2017 Jun 30.
33 Interleukin 6 gene polymorphisms are associated with systemic lupus erythematosus in Koreans.J Rheumatol. 2010 Nov;37(11):2251-8. doi: 10.3899/jrheum.100170. Epub 2010 Sep 15.
34 Single-nucleotide polymorphisms in chromosome 3p14.1- 3p14.2 are associated with susceptibility of type 2 diabetes with cataract.Mol Vis. 2010 Jul 1;16:1206-14.
35 The E6/E7 promoter of extrachromosomal HPV16 DNA in cervical cancers escapes from cellular repression by mutation of target sequences for YY1.EMBO J. 1994 Mar 15;13(6):1460-6. doi: 10.1002/j.1460-2075.1994.tb06400.x.
36 Inactivation of RAS association domain family 1A gene in cervical carcinomas and the role of human papillomavirus infection.Cancer Res. 2003 Apr 15;63(8):1888-93.
37 Agomelatine, a novel therapeutic option for the management of irritable bowel syndrome.J Clin Pharm Ther. 2018 Oct;43(5):752-756. doi: 10.1111/jcpt.12749. Epub 2018 Jul 16.
38 Characterization of 5-HT3 receptor mutations identified in schizophrenic patients.J Mol Neurosci. 2006;30(3):273-81. doi: 10.1385/JMN:30:3:273.
39 Putative role of functional interferon regulatory factor 5 (IRF5) polymorphism in rheumatoid arthritis in a Korean population.J Rheumatol. 2008 Nov;35(11):2106-18. doi: 10.3899/jrheum.080114. Epub 2008 Oct 1.
40 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.