Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGP7UKA)

DOT Name Ly6/PLAUR domain-containing protein 5 (LYPD5)
Gene Name LYPD5
Related Disease
Adenocarcinoma ( )
B-cell lymphoma ( )
Type-1 diabetes ( )
Bone osteosarcoma ( )
Breast neoplasm ( )
Carcinoma ( )
Cervical cancer ( )
Cervical carcinoma ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epithelial neoplasm ( )
Esophageal squamous cell carcinoma ( )
Hepatitis B virus infection ( )
Hepatocellular carcinoma ( )
Lung adenocarcinoma ( )
Melanoma ( )
Metastatic malignant neoplasm ( )
Metastatic prostate carcinoma ( )
Non-small-cell lung cancer ( )
Osteosarcoma ( )
Pancreatic cancer ( )
Squamous cell carcinoma ( )
B-cell neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Gastric cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Stomach cancer ( )
Neuroblastoma ( )
Parkinson disease ( )
Advanced cancer ( )
Colorectal carcinoma ( )
Human papillomavirus infection ( )
Lung neoplasm ( )
Nasopharyngeal carcinoma ( )
Neoplasm ( )
Schistosomiasis ( )
UniProt ID
LYPD5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00021
Sequence
MAMGVPRVILLCLFGAALCLTGSQALQCYSFEHTYFGPFDLRAMKLPSISCPHECFEAIL
SLDTGYRAPVTLVRKGCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPN
LSQAPDPPTLSGAECYACIGVHQDDCAIGRSRRVQCHQDQTACFQGNGRMTVGNFSVPVY
IRTCHRPSCTTEGTTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSASATTPPRALQVLALL
LPVLLLVGLSA
Reactome Pathway
Post-translational modification (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenocarcinoma DIS3IHTY Definitive Biomarker [1]
B-cell lymphoma DISIH1YQ Definitive Altered Expression [2]
Type-1 diabetes DIS7HLUB Definitive Altered Expression [3]
Bone osteosarcoma DIST1004 Strong Biomarker [4]
Breast neoplasm DISNGJLM Strong Biomarker [5]
Carcinoma DISH9F1N Strong Biomarker [6]
Cervical cancer DISFSHPF Strong Biomarker [7]
Cervical carcinoma DIST4S00 Strong Biomarker [7]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [8]
Colon cancer DISVC52G Strong Altered Expression [9]
Colon carcinoma DISJYKUO Strong Altered Expression [9]
Endometrial cancer DISW0LMR Strong Biomarker [10]
Endometrial carcinoma DISXR5CY Strong Biomarker [10]
Epithelial neoplasm DIS0T594 Strong Biomarker [11]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [12]
Hepatitis B virus infection DISLQ2XY Strong Altered Expression [13]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [14]
Lung adenocarcinoma DISD51WR Strong Biomarker [15]
Melanoma DIS1RRCY Strong Altered Expression [16]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [17]
Metastatic prostate carcinoma DISVBEZ9 Strong Altered Expression [18]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [19]
Osteosarcoma DISLQ7E2 Strong Biomarker [4]
Pancreatic cancer DISJC981 Strong Biomarker [20]
Squamous cell carcinoma DISQVIFL Strong Biomarker [21]
B-cell neoplasm DISVY326 moderate Altered Expression [2]
Breast cancer DIS7DPX1 moderate Biomarker [22]
Breast carcinoma DIS2UE88 moderate Biomarker [22]
Gastric cancer DISXGOUK moderate Biomarker [23]
Prostate cancer DISF190Y moderate Altered Expression [24]
Prostate carcinoma DISMJPLE moderate Altered Expression [24]
Stomach cancer DISKIJSX moderate Biomarker [23]
Neuroblastoma DISVZBI4 Disputed Altered Expression [25]
Parkinson disease DISQVHKL Disputed Biomarker [26]
Advanced cancer DISAT1Z9 Limited Altered Expression [12]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [27]
Human papillomavirus infection DISX61LX Limited Altered Expression [28]
Lung neoplasm DISVARNB Limited Altered Expression [28]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [29]
Neoplasm DISZKGEW Limited Altered Expression [24]
Schistosomiasis DIS6PD44 Limited Genetic Variation [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Ly6/PLAUR domain-containing protein 5 (LYPD5). [31]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Ly6/PLAUR domain-containing protein 5 (LYPD5). [34]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Ly6/PLAUR domain-containing protein 5 (LYPD5). [32]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Ly6/PLAUR domain-containing protein 5 (LYPD5). [33]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Ly6/PLAUR domain-containing protein 5 (LYPD5). [35]
------------------------------------------------------------------------------------

References

1 Analysis of MAT3 gene expression in NSCLC.Diagn Pathol. 2013 Oct 9;8:166. doi: 10.1186/1746-1596-8-166.
2 Identification of Pax5 as a target of MTA1 in B-cell lymphomas.Cancer Res. 2007 Aug 1;67(15):7132-8. doi: 10.1158/0008-5472.CAN-07-0750.
3 Type 1 diabetes upregulates metastasis-associated protein 1- phosphorylated histone 2AX signaling in the testis.Eur J Pharmacol. 2019 Mar 5;846:30-37. doi: 10.1016/j.ejphar.2019.01.019. Epub 2019 Jan 16.
4 MicroRNA-183 suppresses the vitality, invasion and migration of human osteosarcoma cells by targeting metastasis-associated protein 1.Exp Ther Med. 2018 Jun;15(6):5058-5064. doi: 10.3892/etm.2018.6068. Epub 2018 Apr 13.
5 Metastasis-associated protein 2 is a repressor of estrogen receptor alpha whose overexpression leads to estrogen-independent growth of human breast cancer cells.Mol Endocrinol. 2006 Sep;20(9):2020-35. doi: 10.1210/me.2005-0063. Epub 2006 Apr 27.
6 Relation between prognosis and expression of metastasis-associated protein 1 in stage I non-small cell lung cancer.Interact Cardiovasc Thorac Surg. 2011 Feb;12(2):166-9. doi: 10.1510/icvts.2010.243741. Epub 2010 Oct 8.
7 Upregulation of MTA1 expression by human papillomavirus infection promotes CDDP resistance in cervical cancer cells via modulation of NF-B/APOBEC3B cascade.Cancer Chemother Pharmacol. 2019 Apr;83(4):625-637. doi: 10.1007/s00280-018-03766-2. Epub 2019 Jan 10.
8 MiR-367 regulates cell proliferation and metastasis by targeting metastasis-associated protein 3 (MTA3) in clear-cell renal cell carcinoma.Oncotarget. 2017 Jun 27;8(38):63084-63095. doi: 10.18632/oncotarget.18647. eCollection 2017 Sep 8.
9 Expression of histone deacetylase 1 and metastasis-associated protein 1 as prognostic factors in colon cancer.Oncol Rep. 2011 Aug;26(2):343-8. doi: 10.3892/or.2011.1312. Epub 2011 May 20.
10 Metastasis-associated protein 1, modulated by miR-30c, promotes endometrial cancer progression through AKT/mTOR/4E-BP1 pathway.Gynecol Oncol. 2019 Jul;154(1):207-217. doi: 10.1016/j.ygyno.2019.04.005. Epub 2019 Apr 9.
11 Breast cancer-amplified sequence 3, a target of metastasis-associated protein 1, contributes to tamoxifen resistance in premenopausal patients with breast cancer.Cell Cycle. 2006 Jul;5(13):1407-10. doi: 10.4161/cc.5.13.2924. Epub 2006 Jul 1.
12 MTA1 promotes tumorigenesis and development of esophageal squamous cell carcinoma via activating the MEK/ERK/p90RSK signaling pathway.Carcinogenesis. 2020 Sep 24;41(9):1263-1272. doi: 10.1093/carcin/bgz200.
13 Stimulation of inducible nitric oxide by hepatitis B virus transactivator protein HBx requires MTA1 coregulator. J Biol Chem. 2010 Mar 5;285(10):6980-6.
14 The E3 ligase for metastasis associated 1 protein, TRIM25, is targeted by microRNA-873 in hepatocellular carcinoma.Exp Cell Res. 2018 Jul 1;368(1):37-41. doi: 10.1016/j.yexcr.2018.04.010. Epub 2018 Apr 12.
15 Relationship between MTA1 and spread through air space and their joint influence on prognosis of patients with stage I-III lung adenocarcinoma.Lung Cancer. 2018 Oct;124:211-218. doi: 10.1016/j.lungcan.2018.07.040. Epub 2018 Jul 29.
16 Expression of CD44v3 splice variant is associated with the visceral metastatic phenotype of human melanoma.Virchows Arch. 2001 Nov;439(5):628-35. doi: 10.1007/s004280100451.
17 Metastasis-Associated Protein 1 Is Involved in Angiogenesis after Transarterial Chemoembolization Treatment.Biomed Res Int. 2017;2017:6757898. doi: 10.1155/2017/6757898. Epub 2017 May 15.
18 Targeting MTA1/HIF-1 signaling by pterostilbene in combination with histone deacetylase inhibitor attenuates prostate cancer progression.Cancer Med. 2017 Nov;6(11):2673-2685. doi: 10.1002/cam4.1209. Epub 2017 Oct 10.
19 MTA1 promotes epithelial to mesenchymal transition and metastasis in non-small-cell lung cancer.Oncotarget. 2017 Jun 13;8(24):38825-38840. doi: 10.18632/oncotarget.16404.
20 AGR2 is a novel surface antigen that promotes the dissemination of pancreatic cancer cells through regulation of cathepsins B and D.Cancer Res. 2011 Nov 15;71(22):7091-102. doi: 10.1158/0008-5472.CAN-11-1367. Epub 2011 Sep 26.
21 MTA3-SOX2 Module Regulates Cancer Stemness and Contributes to Clinical Outcomes of Tongue Carcinoma.Front Oncol. 2019 Aug 27;9:816. doi: 10.3389/fonc.2019.00816. eCollection 2019.
22 Overexpression of MTA1 inhibits the metastatic ability of ZR-75-30 cells in vitro by promoting MTA2 degradation.Cell Commun Signal. 2019 Jan 14;17(1):4. doi: 10.1186/s12964-019-0318-6.
23 MiR-30c-5p suppresses migration, invasion and epithelial to mesenchymal transition of gastric cancer via targeting MTA1.Biomed Pharmacother. 2017 Sep;93:554-560. doi: 10.1016/j.biopha.2017.06.084. Epub 2017 Jul 4.
24 MTA1-Dependent Anticancer Activity of Gnetin C in Prostate Cancer.Nutrients. 2019 Sep 4;11(9):2096. doi: 10.3390/nu11092096.
25 FGF represses metastasis of neuroblastoma regulated by MYCN and TGF-1 induced LMO1 via control of let-7 expression.Brain Res. 2019 Feb 1;1704:219-228. doi: 10.1016/j.brainres.2018.10.015. Epub 2018 Oct 12.
26 Molecular Mechanism of Regulation of MTA1 Expression by Granulocyte Colony-stimulating Factor.J Biol Chem. 2016 Jun 3;291(23):12310-21. doi: 10.1074/jbc.M115.707224. Epub 2016 Apr 4.
27 microRNA-182 targets special AT-rich sequence-binding protein 2 to promote colorectal cancer proliferation and metastasis.J Transl Med. 2014 May 1;12:109. doi: 10.1186/1479-5876-12-109.
28 MiR-30c-2* negative regulated MTA-1 expression involved in metastasis and drug resistance of HPV-infected non-small cell lung cancer.Surgery. 2016 Dec;160(6):1591-1598. doi: 10.1016/j.surg.2016.06.025. Epub 2016 Aug 6.
29 MiR-183 overexpression inhibits tumorigenesis and enhances DDP-induced cytotoxicity by targeting MTA1 in nasopharyngeal carcinoma.Tumour Biol. 2017 Jun;39(6):1010428317703825. doi: 10.1177/1010428317703825.
30 The metastasis-associated protein-1 gene encodes a host permissive factor for schistosomiasis, a leading global cause of inflammation and cancer.Hepatology. 2011 Jul;54(1):285-95. doi: 10.1002/hep.24354. Epub 2011 Jun 8.
31 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
32 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
33 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
34 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.