Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH1VZTM)

DOT Name 26S proteasome non-ATPase regulatory subunit 4 (PSMD4)
Synonyms 26S proteasome regulatory subunit RPN10; 26S proteasome regulatory subunit S5A; Antisecretory factor 1; AF; ASF; Multiubiquitin chain-binding protein
Gene Name PSMD4
Related Disease
Angelman syndrome ( )
Cervical cancer ( )
Cervical carcinoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Advanced cancer ( )
Androgen insensitivity syndrome ( )
Atrial fibrillation ( )
Autoimmune disease ( )
Autosomal dominant vitreoretinochoroidopathy ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma of esophagus ( )
Disease of orbital part of eye adnexa ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Esophageal cancer ( )
Gastric cancer ( )
Inflammatory bowel disease ( )
Influenza ( )
Lung neoplasm ( )
Malignant soft tissue neoplasm ( )
Metastatic malignant neoplasm ( )
Multiple sclerosis ( )
Myositis disease ( )
Neoplasm of esophagus ( )
Plasma cell myeloma ( )
Progressive multifocal leukoencephalopathy ( )
Sarcoma ( )
Spinal muscular atrophy ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Stroke ( )
Systemic lupus erythematosus ( )
Viral hemorrhagic fever ( )
Vitelliform macular dystrophy ( )
Colorectal carcinoma ( )
Hepatocellular carcinoma ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Liver cancer ( )
Neuroblastoma ( )
Non-small-cell lung cancer ( )
UniProt ID
PSMD4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1P9C ; 1P9D ; 1UEL ; 1YX4 ; 1YX5 ; 1YX6 ; 2KDE ; 2KDF ; 5GJQ ; 5GJR ; 5L4K ; 5LN3 ; 5M32 ; 5T0C ; 5T0G ; 5T0H ; 5T0I ; 5T0J ; 5VFP ; 5VFQ ; 5VFR ; 5VFS ; 5VFT ; 5VFU ; 5VGZ ; 5VHF ; 5VHH ; 5VHI ; 5VHS ; 6MSB ; 6MSD ; 6MSE ; 6MSG ; 6MSH ; 6MSJ ; 6MSK ; 6MUN ; 6U19 ; 6WJD ; 6WJN ; 7QXN ; 7QXP ; 7QXU ; 7QXW ; 7QXX ; 7QY7 ; 7QYA ; 7QYB ; 7W37 ; 7W38 ; 7W39 ; 7W3A ; 7W3B ; 7W3C ; 7W3F ; 7W3G ; 7W3H ; 7W3I ; 7W3J ; 7W3K ; 7W3M ; 8CVT
Pfam ID
PF02809 ; PF13519
Sequence
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
ASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLA
SQATKDGKKDKKEEDKK
Function
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. PSMD4 acts as an ubiquitin receptor subunit through ubiquitin-interacting motifs and selects ubiquitin-conjugates for destruction. Displays a preferred selectivity for longer polyubiquitin chains.
KEGG Pathway
Proteasome (hsa03050 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Amyotrophic lateral sclerosis (hsa05014 )
Huntington disease (hsa05016 )
Spinocerebellar ataxia (hsa05017 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Epstein-Barr virus infection (hsa05169 )
Reactome Pathway
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176 )
ER-Phagosome pathway (R-HSA-1236974 )
Cross-presentation of soluble exogenous antigens (endosomes) (R-HSA-1236978 )
Autodegradation of Cdh1 by Cdh1 (R-HSA-174084 )
SCF-beta-TrCP mediated degradation of Emi1 (R-HSA-174113 )
APC/C (R-HSA-174154 )
APC/C (R-HSA-174178 )
Cdc20 (R-HSA-174184 )
Vpu mediated degradation of CD4 (R-HSA-180534 )
Vif-mediated degradation of APOBEC3G (R-HSA-180585 )
SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577 )
Degradation of beta-catenin by the destruction complex (R-HSA-195253 )
Downstream TCR signaling (R-HSA-202424 )
Regulation of activated PAK-2p34 by proteasome mediated degradation (R-HSA-211733 )
Separation of Sister Chromatids (R-HSA-2467813 )
FCERI mediated NF-kB activation (R-HSA-2871837 )
Autodegradation of the E3 ubiquitin ligase COP1 (R-HSA-349425 )
Regulation of ornithine decarboxylase (ODC) (R-HSA-350562 )
ABC-family proteins mediated transport (R-HSA-382556 )
AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408 )
Asymmetric localization of PCP proteins (R-HSA-4608870 )
Degradation of AXIN (R-HSA-4641257 )
Degradation of DVL (R-HSA-4641258 )
Hedgehog ligand biogenesis (R-HSA-5358346 )
Hh mutants are degraded by ERAD (R-HSA-5362768 )
Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761 )
CLEC7A (Dectin-1) signaling (R-HSA-5607764 )
Degradation of GLI1 by the proteasome (R-HSA-5610780 )
Degradation of GLI2 by the proteasome (R-HSA-5610783 )
GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785 )
Hedgehog 'on' state (R-HSA-5632684 )
Regulation of RAS by GAPs (R-HSA-5658442 )
TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 )
NIK-->noncanonical NF-kB signaling (R-HSA-5676590 )
Defective CFTR causes cystic fibrosis (R-HSA-5678895 )
MAPK6/MAPK4 signaling (R-HSA-5687128 )
UCH proteinases (R-HSA-5689603 )
Ub-specific processing proteases (R-HSA-5689880 )
Assembly of the pre-replicative complex (R-HSA-68867 )
Orc1 removal from chromatin (R-HSA-68949 )
CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017 )
G2/M Checkpoints (R-HSA-69481 )
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (R-HSA-69601 )
Ubiquitin-dependent degradation of Cyclin D (R-HSA-75815 )
The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 )
FBXL7 down-regulates AURKA during mitotic entry and in early mitosis (R-HSA-8854050 )
RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 )
Regulation of RUNX2 expression and activity (R-HSA-8939902 )
Regulation of RUNX3 expression and activity (R-HSA-8941858 )
Regulation of PTEN stability and activity (R-HSA-8948751 )
Neddylation (R-HSA-8951664 )
Regulation of expression of SLITs and ROBOs (R-HSA-9010553 )
Interleukin-1 signaling (R-HSA-9020702 )
Negative regulation of NOTCH4 signaling (R-HSA-9604323 )
KEAP1-NFE2L2 pathway (R-HSA-9755511 )
GSK3B and BTRC (R-HSA-9762114 )
Somitogenesis (R-HSA-9824272 )
Antigen processing (R-HSA-983168 )
Activation of NF-kappaB in B cells (R-HSA-1169091 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Angelman syndrome DIS4QVXO Definitive Genetic Variation [1]
Cervical cancer DISFSHPF Definitive Altered Expression [2]
Cervical carcinoma DIST4S00 Definitive Altered Expression [2]
Prostate cancer DISF190Y Definitive Altered Expression [3]
Prostate carcinoma DISMJPLE Definitive Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Androgen insensitivity syndrome DISUZBBO Strong Biomarker [5]
Atrial fibrillation DIS15W6U Strong Genetic Variation [6]
Autoimmune disease DISORMTM Strong Biomarker [7]
Autosomal dominant vitreoretinochoroidopathy DISXZJ1T Strong Genetic Variation [8]
Breast cancer DIS7DPX1 Strong Biomarker [9]
Breast carcinoma DIS2UE88 Strong Biomarker [9]
Carcinoma of esophagus DISS6G4D Strong Altered Expression [10]
Disease of orbital part of eye adnexa DISGWPWX Strong Biomarker [6]
Endometrial cancer DISW0LMR Strong Altered Expression [4]
Endometrial carcinoma DISXR5CY Strong Altered Expression [4]
Esophageal cancer DISGB2VN Strong Altered Expression [10]
Gastric cancer DISXGOUK Strong Biomarker [11]
Inflammatory bowel disease DISGN23E Strong Biomarker [12]
Influenza DIS3PNU3 Strong Biomarker [13]
Lung neoplasm DISVARNB Strong Altered Expression [14]
Malignant soft tissue neoplasm DISTC6NO Strong Altered Expression [15]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [16]
Multiple sclerosis DISB2WZI Strong Biomarker [17]
Myositis disease DISCIXF0 Strong Altered Expression [18]
Neoplasm of esophagus DISOLKAQ Strong Altered Expression [10]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [19]
Progressive multifocal leukoencephalopathy DISX02WS Strong Biomarker [20]
Sarcoma DISZDG3U Strong Altered Expression [15]
Spinal muscular atrophy DISTLKOB Strong Biomarker [21]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [22]
Stomach cancer DISKIJSX Strong Biomarker [11]
Stroke DISX6UHX Strong Genetic Variation [6]
Systemic lupus erythematosus DISI1SZ7 Strong Altered Expression [23]
Viral hemorrhagic fever DISQEBTU Strong Biomarker [24]
Vitelliform macular dystrophy DISEFYYN Strong Genetic Variation [8]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [25]
Hepatocellular carcinoma DIS0J828 moderate Biomarker [4]
Coronary atherosclerosis DISKNDYU Disputed Biomarker [26]
Coronary heart disease DIS5OIP1 Disputed Biomarker [26]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Limited Biomarker [27]
Liver cancer DISDE4BI Limited Biomarker [27]
Neuroblastoma DISVZBI4 Limited Biomarker [28]
Non-small-cell lung cancer DIS5Y6R9 Limited Biomarker [29]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [30]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [31]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [32]
Selenium DM25CGV Approved Selenium increases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [35]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [35]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [37]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [38]
Butanoic acid DMTAJP7 Investigative Butanoic acid decreases the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [39]
Aminohippuric acid DMUN54G Investigative Aminohippuric acid affects the expression of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic decreases the ubiquitination of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [33]
Quercetin DM3NC4M Approved Quercetin increases the phosphorylation of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [34]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [36]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of 26S proteasome non-ATPase regulatory subunit 4 (PSMD4). [34]
------------------------------------------------------------------------------------

References

1 Angelman syndrome-associated point mutations in the Zn(2+)-binding N-terminal (AZUL) domain of UBE3A ubiquitin ligase inhibit binding to the proteasome.J Biol Chem. 2018 Nov 23;293(47):18387-18399. doi: 10.1074/jbc.RA118.004653. Epub 2018 Sep 26.
2 Gene expression signatures of angiocidin and darapladib treatment connect to therapy options in cervical cancer.J Cancer Res Clin Oncol. 2013 Feb;139(2):259-67. doi: 10.1007/s00432-012-1317-9. Epub 2012 Oct 9.
3 miR?0c suppresses prostate cancer survival by targeting the ASF/SF2 splicing factor oncoprotein.Mol Med Rep. 2017 Sep;16(3):2431-2438. doi: 10.3892/mmr.2017.6910. Epub 2017 Jul 4.
4 Inhibition of PSMD4 blocks the tumorigenesis of hepatocellular carcinoma.Gene. 2019 Jun 20;702:66-74. doi: 10.1016/j.gene.2019.03.063. Epub 2019 Mar 28.
5 Selective Fusion in Lenke 5 Adolescent Idiopathic Scoliosis.World Neurosurg. 2018 Oct;118:e784-e791. doi: 10.1016/j.wneu.2018.07.052. Epub 2018 Jul 18.
6 Stroke Risk and Treatment in Patients with Atrial Fibrillation and Low CHA(2)DS(2)-VASc Scores: Findings From the ORBIT-AF I and II Registries.J Am Heart Assoc. 2018 Aug 21;7(16):e008764. doi: 10.1161/JAHA.118.008764.
7 Angiocidin promotes pro-inflammatory cytokine production and antigen presentation in multiple sclerosis.J Neuroimmunol. 2008 Feb;194(1-2):132-42. doi: 10.1016/j.jneuroim.2007.11.003. Epub 2008 Jan 22.
8 ADVIRC is caused by distinct mutations in BEST1 that alter pre-mRNA splicing. J Med Genet. 2009 Sep;46(9):620-5. doi: 10.1136/jmg.2008.059881. Epub 2008 Jul 8.
9 Proteasome ubiquitin receptor PSMD4 is an amplification target in breast cancer and may predict sensitivity to PARPi.Genes Chromosomes Cancer. 2017 Aug;56(8):589-597. doi: 10.1002/gcc.22459. Epub 2017 May 4.
10 PSMD4 regulates the malignancy of esophageal cancer cells by suppressing endoplasmic reticulum stress.Kaohsiung J Med Sci. 2019 Oct;35(10):591-597. doi: 10.1002/kjm2.12093. Epub 2019 Jun 4.
11 MALAT1 promotes cell proliferation in gastric cancer by recruiting SF2/ASF.Biomed Pharmacother. 2014 Jun;68(5):557-64. doi: 10.1016/j.biopha.2014.04.007. Epub 2014 Apr 28.
12 Vitamin C and B(3) as new biomaterials to alter intestinal stem cells.J Biomed Mater Res A. 2019 Sep;107(9):1886-1897. doi: 10.1002/jbm.a.36715. Epub 2019 May 23.
13 Highly pathogenic avian influenza virus nucleoprotein interacts with TREX complex adaptor protein Aly/REF.PLoS One. 2013 Sep 20;8(9):e72429. doi: 10.1371/journal.pone.0072429. eCollection 2013.
14 The oncoprotein SF2/ASF promotes non-small cell lung cancer survival by enhancing survivin expression.Clin Cancer Res. 2010 Aug 15;16(16):4113-25. doi: 10.1158/1078-0432.CCR-10-0076. Epub 2010 Aug 3.
15 The gene encoding the splicing factor SF2/ASF is a proto-oncogene.Nat Struct Mol Biol. 2007 Mar;14(3):185-93. doi: 10.1038/nsmb1209. Epub 2007 Feb 18.
16 Cell motility is controlled by SF2/ASF through alternative splicing of the Ron protooncogene.Mol Cell. 2005 Dec 22;20(6):881-90. doi: 10.1016/j.molcel.2005.10.026.
17 JC polyomavirus expression and bell-shaped regulation of its SF2/ASF suppressor during the follow-up of multiple sclerosis patients treated with natalizumab.J Neurovirol. 2017 Apr;23(2):226-238. doi: 10.1007/s13365-016-0492-x. Epub 2016 Nov 3.
18 Alternative splicing factor ASF/SF2 is down regulated in inflamed muscle.J Clin Pathol. 2006 Aug;59(8):855-61. doi: 10.1136/jcp.2005.032961. Epub 2006 Mar 30.
19 Pharmacogenomics of bortezomib test-dosing identifies hyperexpression of proteasome genes, especially PSMD4, as novel high-risk feature in myeloma treated with Total Therapy 3.Blood. 2011 Sep 29;118(13):3512-24. doi: 10.1182/blood-2010-12-328252. Epub 2011 May 31.
20 Early reduction of the splicing factor2/alternative splicing factor: a cellular inhibitor of the JC polyomavirus in natalizumab-treated MS patients long before developing progressive multifocal leukoencephalopathy.J Neurovirol. 2020 Feb;26(1):133-137. doi: 10.1007/s13365-019-00793-4. Epub 2019 Aug 29.
21 Disruption of an SF2/ASF-dependent exonic splicing enhancer in SMN2 causes spinal muscular atrophy in the absence of SMN1.Nat Genet. 2002 Apr;30(4):377-84. doi: 10.1038/ng854. Epub 2002 Mar 4.
22 Identification of differentially expressed genes in chemically induced skin tumors.Mol Carcinog. 1997 Sep;20(1):88-98.
23 Splicing factor SF2/ASF rescues IL-2 production in T cells from systemic lupus erythematosus patients by activating IL-2 transcription.Proc Natl Acad Sci U S A. 2013 Jan 29;110(5):1845-50. doi: 10.1073/pnas.1214207110. Epub 2013 Jan 14.
24 In silico structural and functional prediction of African swine fever virus protein-B263R reveals features of a TATA-binding protein.PeerJ. 2018 Feb 22;6:e4396. doi: 10.7717/peerj.4396. eCollection 2018.
25 PSMD4 is a novel therapeutic target in chemoresistant colorectal cancer activated by cytoplasmic localization of Nrf2.Oncotarget. 2018 May 29;9(41):26342-26352. doi: 10.18632/oncotarget.25254. eCollection 2018 May 29.
26 International trends in clinical characteristics and oral anticoagulation treatment for patients with atrial fibrillation: Results from the GARFIELD-AF, ORBIT-AF I, and ORBIT-AF II registries.Am Heart J. 2017 Dec;194:132-140. doi: 10.1016/j.ahj.2017.08.011. Epub 2017 Aug 24.
27 Label-free cytosensing of cancer cells based on the interaction between protein and an electron-transfer carbohydrate-mimetic peptide.Anal Chim Acta. 2018 Dec 21;1040:166-176. doi: 10.1016/j.aca.2018.08.025. Epub 2018 Aug 16.
28 MicroRNAs-10a and -10b contribute to retinoic acid-induced differentiation of neuroblastoma cells and target the alternative splicing regulatory factor SFRS1 (SF2/ASF).J Biol Chem. 2011 Feb 11;286(6):4150-64. doi: 10.1074/jbc.M110.167817. Epub 2010 Nov 30.
29 HnRNP A1/A2 and SF2/ASF regulate alternative splicing of interferon regulatory factor-3 and affect immunomodulatory functions in human non-small cell lung cancer cells.PLoS One. 2013 Apr 29;8(4):e62729. doi: 10.1371/journal.pone.0062729. Print 2013.
30 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
31 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
32 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
33 Quantitative Assessment of Arsenite-Induced Perturbation of Ubiquitinated Proteome. Chem Res Toxicol. 2022 Sep 19;35(9):1589-1597. doi: 10.1021/acs.chemrestox.2c00197. Epub 2022 Aug 22.
34 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
35 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
36 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
37 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
38 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
39 MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
40 Identification of molecular signatures predicting the carcinogenicity of polycyclic aromatic hydrocarbons (PAHs). Toxicol Lett. 2012 Jul 7;212(1):18-28. doi: 10.1016/j.toxlet.2012.04.013. Epub 2012 May 1.