Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJBKFA1)

• DOT Name: APOBEC1 complementation factor (A1CF)
• Synonyms: APOBEC1-stimulating protein
• Gene Name: A1CF
• Related Disease:
  Malaria
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Ankylosing spondylitis
  Breast cancer
  Breast carcinoma
  Central diabetes insipidus
  Colorectal carcinoma
  Depression
  Esophageal adenocarcinoma
  Fibrodysplasia ossificans progressiva
  Glioma
  Gout
  Hyperglycemia
  leukaemia
  Leukemia
  Major depressive disorder
  Malignant mesothelioma
  Metastatic malignant neoplasm
  Mitochondrial disease
  Myocardial infarction
  Myocardial ischemia
  Neoplasm
  Non-small-cell lung cancer
  Obesity
  Osteoarthritis
  Pancreatitis
  Polyp
  Premature aging syndrome
  Psoriatic arthritis
  Schizophrenia
  Testicular germ cell tumor
  Acute myelogenous leukaemia
  Advanced cancer
  Lymphoid leukemia
  Rheumatoid arthritis
• UniProt ID: A1CF_HUMAN
• PDB ID: 2CPD
• Pfam ID: PF14709 ; PF00076
• Sequence:
  MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFI
  GKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE
  IRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRG
  FAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLML
  STSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL
  AKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQTYAAIPSLH
  FPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED
  KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFL
  YKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAA
  TAFPGYAVPNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF
• Function: Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.
• Tissue Specificity: Widely expressed with highest levels in brain, liver, pancreas, colon and spleen.
• Reactome Pathway:
  Formation of the Editosome (R-HSA-75094)
  mRNA Editing (R-HSA-72200)

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Malaria	DISQ9Y50	Definitive	Genetic Variation	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[3]
Ankylosing spondylitis	DISRC6IR	Strong	Genetic Variation	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Central diabetes insipidus	DISJ4P9O	Strong	Biomarker	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[7]
Depression	DIS3XJ69	Strong	Biomarker	[8]
Esophageal adenocarcinoma	DISODWFP	Strong	Altered Expression	[9]
Fibrodysplasia ossificans progressiva	DISAT6WU	Strong	Biomarker	[10]
Glioma	DIS5RPEH	Strong	Biomarker	[5]
Gout	DISHC0U7	Strong	Genetic Variation	[11]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[12]
leukaemia	DISS7D1V	Strong	Biomarker	[13]
Leukemia	DISNAKFL	Strong	Biomarker	[13]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[8]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[14]
Metastatic malignant neoplasm	DIS86UK6	Strong	Genetic Variation	[15]
Mitochondrial disease	DISKAHA3	Strong	Genetic Variation	[16]
Myocardial infarction	DIS655KI	Strong	Biomarker	[17]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[18]
Obesity	DIS47Y1K	Strong	Biomarker	[12]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[19]
Pancreatitis	DIS0IJEF	Strong	Biomarker	[20]
Polyp	DISRSLYF	Strong	Biomarker	[21]
Premature aging syndrome	DIS51AGT	Strong	Genetic Variation	[22]
Psoriatic arthritis	DISLWTG2	Strong	Biomarker	[4]
Schizophrenia	DISSRV2N	Strong	Biomarker	[23]
Testicular germ cell tumor	DIS5RN24	Strong	Biomarker	[24]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[25]
Advanced cancer	DISAT1Z9	Disputed	Biomarker	[26]
Lymphoid leukemia	DIS65TYQ	Disputed	Biomarker	[27]
Rheumatoid arthritis	DISTSB4J	Disputed	Biomarker	[4]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Uric acid	DMA1MKT	Investigative	APOBEC1 complementation factor (A1CF) affects the abundance of Uric acid.	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of APOBEC1 complementation factor (A1CF).	[28]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of APOBEC1 complementation factor (A1CF).	[29]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of APOBEC1 complementation factor (A1CF).	[30]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of APOBEC1 complementation factor (A1CF).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of APOBEC1 complementation factor (A1CF).	[32]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of APOBEC1 complementation factor (A1CF).	[33]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of APOBEC1 complementation factor (A1CF).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of APOBEC1 complementation factor (A1CF).	[35]

References

• [1] Genotyping of the Duffy blood group among Plasmodium knowlesi-infected patients in Malaysia.PLoS One. 2014 Sep 30;9(9):e108951. doi: 10.1371/journal.pone.0108951. eCollection 2014.
• [2] Metabolite Profile of Alzheimer's Disease in the Frontal Cortex as Analyzed by HRMAS (1)H NMR.Front Aging Neurosci. 2019 Jan 9;10:424. doi: 10.3389/fnagi.2018.00424. eCollection 2018.
• [3] In vitro activation of GAT1 transporters expressed in spinal cord gliosomes stimulates glutamate release that is abnormally elevated in the SOD1/G93A(+) mouse model of amyotrophic lateral sclerosis.J Neurochem. 2010 Apr;113(2):489-501. doi: 10.1111/j.1471-4159.2010.06628.x. Epub 2010 Feb 1.
• [4] High rates of tuberculin skin test positivity due to methotrexate therapy: False positive results?.Semin Arthritis Rheum. 2018 Dec;48(3):538-546. doi: 10.1016/j.semarthrit.2018.03.018. Epub 2018 Mar 29.
• [5] Inhibition of the aberrant A1CF-FAM224A-miR-590-3p-ZNF143 positive feedback loop attenuated malignant biological behaviors of glioma cells.J Exp Clin Cancer Res. 2019 Jun 11;38(1):248. doi: 10.1186/s13046-019-1200-5.
• [6] Diagnostic stewardship of C. difficile testing: a quasi-experimental antimicrobial stewardship study.Infect Control Hosp Epidemiol. 2019 Mar;40(3):269-275. doi: 10.1017/ice.2018.336. Epub 2019 Feb 21.
• [7] KRAS mutations in non-small-cell lung cancer and colorectal cancer: implications for EGFR-targeted therapies.Lung Cancer. 2014 Feb;83(2):163-7. doi: 10.1016/j.lungcan.2013.11.010. Epub 2013 Nov 21.
• [8] Aversive startle potentiation and fear pathology: Mediating role of threat sensitivity and moderating impact of depression.Int J Psychophysiol. 2015 Nov;98(2 Pt 2):262-269. doi: 10.1016/j.ijpsycho.2014.10.014. Epub 2014 Nov 6.
• [9] Multiple forms of genetic instability within a 2-Mb chromosomal segment of 3q26.3-q27 are associated with development of esophageal adenocarcinoma.Genes Chromosomes Cancer. 2006 Apr;45(4):319-31. doi: 10.1002/gcc.20293.
• [10] Restoration of normal BMP signaling levels and osteogenic differentiation in FOP mesenchymal progenitor cells by mutant allele-specific targeting.Gene Ther. 2012 Jul;19(7):786-90. doi: 10.1038/gt.2011.152. Epub 2011 Oct 20.
• [11] Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.
• [12] The RNA-Binding Protein A1CF Regulates Hepatic Fructose and Glycerol Metabolism via Alternative RNA Splicing.Cell Rep. 2019 Oct 8;29(2):283-300.e8. doi: 10.1016/j.celrep.2019.08.100.
• [13] Growth inhibitory and proapoptotic effects of l-asparaginase from Fusarium culmorum ASP-87 on human leukemia cells (Jurkat).Fundam Clin Pharmacol. 2017 Jun;31(3):292-300. doi: 10.1111/fcp.12257. Epub 2016 Dec 30.
• [14] Can novel adipokines, asprosin and meteorin-like, be biomarkers for malignant mesothelioma?.Biotech Histochem. 2020 Apr;95(3):171-175. doi: 10.1080/10520295.2019.1656344. Epub 2019 Oct 1.
• [15] Sensitive methods for detection of the S768R substitution in exon 18 of the DDR2 gene in patients with central nervous system metastases of non-small cell lung cancer.Med Oncol. 2014 Oct;31(10):176. doi: 10.1007/s12032-014-0176-4. Epub 2014 Aug 31.
• [16] A novel m.7539C>T point mutation in the mt-tRNA(Asp) gene associated with multisystemic mitochondrial disease.Neuromuscul Disord. 2015 Jan;25(1):81-4. doi: 10.1016/j.nmd.2014.09.008. Epub 2014 Sep 28.
• [17] Asprosin improves the survival of mesenchymal stromal cells in myocardial infarction by inhibiting apoptosis via the activated ERK1/2-SOD2 pathway.Life Sci. 2019 Aug 15;231:116554. doi: 10.1016/j.lfs.2019.116554. Epub 2019 Jun 10.
• [18] Sensitive methods for screening of the MEK1 gene mutations in patients with central nervous system metastases of non-small cell lung cancer.Clin Transl Oncol. 2016 Oct;18(10):1039-43. doi: 10.1007/s12094-016-1483-3. Epub 2016 Feb 9.
• [19] Angelica Sinensis polysaccharides stimulated UDP-sugar synthase genes through promoting gene expression of IGF-1 and IGF1R in chondrocytes: promoting anti-osteoarthritic activity.PLoS One. 2014 Sep 9;9(9):e107024. doi: 10.1371/journal.pone.0107024. eCollection 2014.
• [20] Severe drug-induced hypertriglyceridemia treated with plasmapheresis in children with acute lymphoblastic leukemia.Transfus Apher Sci. 2019 Oct;58(5):634-637. doi: 10.1016/j.transci.2019.08.025. Epub 2019 Sep 5.
• [21] Differential expression of organic cation transporters in normal and polyps human nasal epithelium: implications for in vitro drug delivery studies.Int J Pharm. 2011 Mar 15;406(1-2):49-54. doi: 10.1016/j.ijpharm.2010.12.037. Epub 2011 Jan 8.
• [22] Accumulation of deletions and point mutations in mitochondrial genome in degenerative diseases.Ann N Y Acad Sci. 1996 Jun 15;786:102-11. doi: 10.1111/j.1749-6632.1996.tb39055.x.
• [23] C3 Polymorphism Influences Circulating Levels of C3, ASP and Lipids in Schizophrenic Patients.Neurochem Res. 2015 May;40(5):906-14. doi: 10.1007/s11064-015-1543-z. Epub 2015 Feb 27.
• [24] Parent-of-origin effects of A1CF and AGO2 on testicular germ-cell tumors, testicular abnormalities, and fertilization bias.Proc Natl Acad Sci U S A. 2016 Sep 13;113(37):E5425-33. doi: 10.1073/pnas.1604773113. Epub 2016 Aug 31.
• [25] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [26] AS1041, a Novel Synthesized Derivative of Marine Natural Compound Aspergiolide A, Arrests Cell Cycle, Induces Apoptosis, and Inhibits ERK Activation in K562 Cells.Mar Drugs. 2017 Nov 4;15(11):346. doi: 10.3390/md15110346.
• [27] Interaction between Gallic acid and Asparaginase to potentiate anti-proliferative effect on lymphoblastic leukemia cell line.Biomed Pharmacother. 2017 Dec;96:1045-1054. doi: 10.1016/j.biopha.2017.11.122. Epub 2017 Dec 6.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [30] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [31] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [32] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [33] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [34] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [35] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [36] Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.