Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK05PXY)

DOT Name Sodium channel protein type 7 subunit alpha (SCN7A)
Synonyms Atypical sodium channel Nav2.1; Nax channel; Sodium channel protein type VII subunit alpha
Gene Name SCN7A
Related Disease
Type-1/2 diabetes ( )
Adenocarcinoma ( )
Adenoma ( )
Adrenocortical carcinoma ( )
Aplasia cutis congenita ( )
Appendicitis ( )
Autism ( )
Burkitt lymphoma ( )
Cardiac failure ( )
Chronic kidney disease ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Corpus callosum, agenesis of ( )
Cystinosis ( )
Dent disease ( )
Dentatorubral-pallidoluysian atrophy ( )
Dravet syndrome ( )
Epilepsy ( )
Essential hypertension ( )
Focal segmental glomerulosclerosis ( )
Gastric cancer ( )
Glomerulosclerosis ( )
Isolated congenital microcephaly ( )
Liver cirrhosis ( )
Neoplasm ( )
Nephropathy ( )
Neuroblastoma ( )
Oculocerebrorenal syndrome ( )
Oculocutaneous albinism type 1A ( )
Panic disorder ( )
Polyp ( )
Progressive familial intrahepatic cholestasis type 1 ( )
Psoriasis ( )
Renal tubule disorder ( )
Stomach cancer ( )
Temporal lobe epilepsy ( )
Urolithiasis ( )
Lung cancer ( )
Lung carcinoma ( )
Plasma cell myeloma ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Non-insulin dependent diabetes ( )
Cystitis ( )
Malignant pleural mesothelioma ( )
Vibrio cholerae infection ( )
UniProt ID
SCN7A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7TJ8; 7TJ9
Pfam ID
PF00520 ; PF06512
Sequence
MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEEDLKPTPDLEVGKKLPFIYGNLSQG
MVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFF
QLFILISVLIDCVFMSLTNLPKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPW
NWLDFSVTVFEVIIRYSPLDFIPTLQTARTLRILKIIPLNQGLKSLVGVLIHCLKQLIGV
IILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEG
ERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYH
QILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIEPKFQQTGK
ELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAK
TFLIWNCSPCWLKLKEFVHRIIMAPFTDLFLIICIILNVCFLTLEHYPMSKQTNTLLNIG
NLVFIGIFTAEMIFKIIAMHPYGYFQVGWNIFDSMIVFHGLIELCLANVAGMALLRLFRM
LRIFKLGKYWPTFQILMWSLSNSWVALKDLVLLLFTFIFFSAAFGMKLFGKNYEEFVCHI
DKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNLLV
LYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKTQNVPKDTMDH
VNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIAS
GESDIENLDNKEIQSKSGDGGSKEKIKQSSSSECSTVDIAISEEEEMFYGGERSKHLKNG
CRRGSSLGQISGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQ
RKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTR
EELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFSIMGVDLF
AGRFYECIDPTSGERFPSSEVMNKSRCESLLFNESMLWENAKMNFDNVGNGFLSLLQVAT
FNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHK
IKLGGSNIFITVKQRKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVL
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAWNIFDFM
VVIFSITGLCLPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPKVFHNLMLPLMLSLPAL
LNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDVSNFETFGNSMLCLFQVAIFAGWDGML
DAIFNSKWSDCDPDKINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLN
IASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLI
ALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFKITCEPITTTL
KRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATKEGAYFDKAKEKSPIQS
QI
Function
Sodium leak channel functioning as an osmosensor regulating sodium ion levels in various tissues and organs. While most sodium channels are voltage-gated, SCN7A is not and lets sodium flow through membrane along its concentration gradient. In glial cells of the central nervous system, senses body-fluid sodium levels and controls salt intake behavior as well as voluntary water intake through activation of nearby neurons to maintain appropriate sodium levels in the body. By mediating sodium influx into keratinocytes, also plays a role in skin barrier homeostasis.
Tissue Specificity Heart and uterus.
KEGG Pathway
Adrenergic sig.ling in cardiomyocytes (hsa04261 )
Reactome Pathway
Phase 0 - rapid depolarisation (R-HSA-5576892 )
Interaction between L1 and Ankyrins (R-HSA-445095 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Type-1/2 diabetes DISIUHAP Definitive Biomarker [1]
Adenocarcinoma DIS3IHTY Strong Genetic Variation [2]
Adenoma DIS78ZEV Strong Biomarker [3]
Adrenocortical carcinoma DISZF4HX Strong Altered Expression [3]
Aplasia cutis congenita DISMDAYM Strong Biomarker [3]
Appendicitis DIS4GOLF Strong Biomarker [4]
Autism DISV4V1Z Strong Biomarker [5]
Burkitt lymphoma DIS9D5XU Strong Altered Expression [6]
Cardiac failure DISDC067 Strong Genetic Variation [7]
Chronic kidney disease DISW82R7 Strong Altered Expression [8]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [9]
Congestive heart failure DIS32MEA Strong Genetic Variation [7]
Corpus callosum, agenesis of DISO9P40 Strong Biomarker [3]
Cystinosis DISXY3VI Strong Biomarker [10]
Dent disease DISRDLFN Strong Biomarker [10]
Dentatorubral-pallidoluysian atrophy DISHWE0K Strong Altered Expression [11]
Dravet syndrome DISJF7LY Strong Biomarker [12]
Epilepsy DISBB28L Strong Biomarker [13]
Essential hypertension DIS7WI98 Strong Genetic Variation [14]
Focal segmental glomerulosclerosis DISJNHH0 Strong Biomarker [15]
Gastric cancer DISXGOUK Strong Genetic Variation [16]
Glomerulosclerosis DISJF20Z Strong Biomarker [17]
Isolated congenital microcephaly DISUXHZ6 Strong Biomarker [12]
Liver cirrhosis DIS4G1GX Strong Biomarker [18]
Neoplasm DISZKGEW Strong Biomarker [3]
Nephropathy DISXWP4P Strong Biomarker [19]
Neuroblastoma DISVZBI4 Strong Biomarker [20]
Oculocerebrorenal syndrome DIS8TEDY Strong Biomarker [10]
Oculocutaneous albinism type 1A DIS9AICT Strong Altered Expression [11]
Panic disorder DISD3VNY Strong Biomarker [21]
Polyp DISRSLYF Strong Genetic Variation [22]
Progressive familial intrahepatic cholestasis type 1 DISU0AJE Strong Biomarker [23]
Psoriasis DIS59VMN Strong Genetic Variation [24]
Renal tubule disorder DISAFXMQ Strong Biomarker [11]
Stomach cancer DISKIJSX Strong Genetic Variation [16]
Temporal lobe epilepsy DISNOPXX Strong Altered Expression [13]
Urolithiasis DISNFTKT Strong Biomarker [25]
Lung cancer DISCM4YA moderate Biomarker [26]
Lung carcinoma DISTR26C moderate Biomarker [26]
Plasma cell myeloma DIS0DFZ0 moderate Biomarker [27]
Arteriosclerosis DISK5QGC Disputed Biomarker [28]
Atherosclerosis DISMN9J3 Disputed Biomarker [28]
Non-insulin dependent diabetes DISK1O5Z Disputed Biomarker [28]
Cystitis DIS2D4B9 Limited Altered Expression [29]
Malignant pleural mesothelioma DIST2R60 Limited Altered Expression [30]
Vibrio cholerae infection DISW7E3U Limited Genetic Variation [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Sodium channel protein type 7 subunit alpha (SCN7A). [32]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Sodium channel protein type 7 subunit alpha (SCN7A). [33]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Sodium channel protein type 7 subunit alpha (SCN7A). [34]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Sodium channel protein type 7 subunit alpha (SCN7A). [35]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Sodium channel protein type 7 subunit alpha (SCN7A). [36]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Sodium channel protein type 7 subunit alpha (SCN7A). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Sodium channel protein type 7 subunit alpha (SCN7A). [37]
------------------------------------------------------------------------------------

References

1 Challenging the conventional wisdom on diabetic nephropathy: Is microalbuminuria the earliest event?.J Diabetes Complications. 2019 Mar;33(3):191-192. doi: 10.1016/j.jdiacomp.2018.12.006. Epub 2018 Dec 14.
2 Are Helicobacter pylori highly cytotoxic genotypes and cardia gastric adenocarcinoma linked? Lessons from Iran.Cancer Biomark. 2017 Dec 12;21(1):235-246. doi: 10.3233/CBM-170701.
3 Livin/BIRC7 expression as malignancy marker in adrenocortical tumors.Oncotarget. 2017 Feb 7;8(6):9323-9338. doi: 10.18632/oncotarget.14067.
4 Evaluation of the diagnostic performance of a decision tree model in suspected acute appendicitis with equivocal preoperative computed tomography findings compared with Alvarado, Eskelinen, and adult appendicitis scores: A STARD compliant article.Medicine (Baltimore). 2019 Oct;98(40):e17368. doi: 10.1097/MD.0000000000017368.
5 Identifying autism loci and genes by tracing recent shared ancestry.Science. 2008 Jul 11;321(5886):218-23. doi: 10.1126/science.1157657.
6 Expression of a particular beta-N-acetylglucosaminidase isoenzyme in human haematopoietic leukemic cell-lines.Cell Biochem Funct. 1986 Jul;4(3):197-203. doi: 10.1002/cbf.290040306.
7 Evaluations of the effect of HuangQi against heart failure based on comprehensive echocardiography index and metabonomics.Phytomedicine. 2018 Nov 15;50:205-212. doi: 10.1016/j.phymed.2018.04.027. Epub 2018 Apr 10.
8 Performance of urinary kidney injury molecule-1, neutrophil gelatinase-associated lipocalin, and N-acetyl--D-glucosaminidase to predict chronic kidney disease progression and adverse outcomes.Braz J Med Biol Res. 2017 Mar 30;50(5):e6106. doi: 10.1590/1414-431X20176106.
9 Quantitative analysis of gene expression in fixed colorectal carcinoma samples as a method for biomarker validation.Mol Med Rep. 2016 Jun;13(6):5084-92. doi: 10.3892/mmr.2016.5200. Epub 2016 Apr 27.
10 Lysosomal enzymuria is a feature of hereditary Fanconi syndrome and is related to elevated CI-mannose-6-P-receptor excretion.Nephrol Dial Transplant. 2008 Sep;23(9):2795-803. doi: 10.1093/ndt/gfm898. Epub 2008 Jan 3.
11 Assessment and prediction of acute kidney injury in patients with decompensated cirrhosis with serum cystatin C and urine N-acetyl--D-glucosaminidase.J Gastroenterol Hepatol. 2019 Jan;34(1):234-240. doi: 10.1111/jgh.14387. Epub 2018 Aug 21.
12 Epilepsy phenotype associated with a chromosome 2q24.3 deletion involving SCN1A: Migrating partial seizures of infancy or atypical Dravet syndrome?.Epilepsy Res. 2015 Jan;109:34-9. doi: 10.1016/j.eplepsyres.2014.10.008. Epub 2014 Oct 28.
13 Induction of sodium channel Na(x) (SCN7A) expression in rat and human hippocampus in temporal lobe epilepsy.Epilepsia. 2010 Sep;51(9):1791-800. doi: 10.1111/j.1528-1167.2010.02678.x. Epub 2010 Aug 5.
14 The association between the polymorphisms in a sodium channel gene SCN7A and essential hypertension: a case-control study in the Northern Han Chinese.Ann Hum Genet. 2015 Jan;79(1):28-36. doi: 10.1111/ahg.12085. Epub 2014 Nov 13.
15 Clinical Significance of Urinary Biomarkers in Patients With Primary Focal Segmental Glomerulosclerosis.Am J Med Sci. 2018 Apr;355(4):314-321. doi: 10.1016/j.amjms.2017.12.019. Epub 2017 Dec 30.
16 Helicobacter pylori babA2 Positivity Predicts Risk of Gastric Cancer in Ardabil, a Very High-Risk Area in Iran.Asian Pac J Cancer Prev. 2016;17(2):733-8. doi: 10.7314/apjcp.2016.17.2.733.
17 Dapagliflozin attenuates early markers of diabetic nephropathy in fructose-streptozotocin-induced diabetes in rats.Biomed Pharmacother. 2019 Jan;109:910-920. doi: 10.1016/j.biopha.2018.10.100. Epub 2018 Nov 5.
18 How to estimate renal function in patients with liver disease: choosing the most suitable equation.Int Urol Nephrol. 2019 Apr;51(4):677-690. doi: 10.1007/s11255-019-02110-8. Epub 2019 Mar 4.
19 NAG-targeting fluorescence based probe for precision diagnosis of kidney injury.Chem Commun (Camb). 2019 Feb 7;55(13):1955-1958. doi: 10.1039/c8cc10311a.
20 Copy number status and mutation analyses of anaplastic lymphoma kinase (ALK) gene in 90 sporadic neuroblastoma tumors.Cancer Lett. 2012 Apr 1;317(1):72-7. doi: 10.1016/j.canlet.2011.11.013. Epub 2011 Nov 13.
21 An association of NAG levels and a mutation of the CCK gene in panic disorder patients.Psychiatry Res. 1998 Aug 17;80(2):149-53. doi: 10.1016/s0165-1781(98)00063-8.
22 Nonsteroidal anti-inflammatory drug-activated gene-1 over expression in transgenic mice suppresses intestinal neoplasia.Gastroenterology. 2006 Nov;131(5):1553-60. doi: 10.1053/j.gastro.2006.09.015. Epub 2006 Sep 19.
23 Plasma endothelin-1 levels of children with cirrhosis.J Pediatr Gastroenterol Nutr. 1995 Aug;21(2):220-3. doi: 10.1097/00005176-199508000-00015.
24 Kidney involvement in psoriasis: a case-control study from China.Int Urol Nephrol. 2017 Nov;49(11):1999-2003. doi: 10.1007/s11255-017-1692-x. Epub 2017 Sep 22.
25 Urinary biomarkers in the early detection and follow-up of tubular injury in childhood urolithiasis.Clin Exp Nephrol. 2018 Feb;22(1):133-141. doi: 10.1007/s10157-017-1436-3. Epub 2017 Jun 26.
26 Differentially expressed protein-coding genes and long noncoding RNA in early-stage lung cancer.Tumour Biol. 2015 Dec;36(12):9969-78. doi: 10.1007/s13277-015-3714-6. Epub 2015 Jul 16.
27 Urinary NGAL for the diagnosis of the renal injury from multiple myeloma.Cancer Biomark. 2017;18(1):41-46. doi: 10.3233/CBM-160672.
28 The renal tubular damage marker urinary N-acetyl--D-glucosaminidase may be more closely associated with early detection of atherosclerosis than the glomerular damage marker albuminuria in patients with type 2 diabetes.Cardiovasc Diabetol. 2017 Jan 26;16(1):16. doi: 10.1186/s12933-017-0497-7.
29 Urine protein, urine protein to creatinine ratio and N-acetyl--D-glucosaminidase index in cats with idiopathic cystitis vs healthy control cats.J Feline Med Surg. 2017 Aug;19(8):869-875. doi: 10.1177/1098612X16663593. Epub 2016 Aug 18.
30 Antiproliferative Activity of Pt(IV) Conjugates Containing the Non-Steroidal Anti-Inflammatory Drugs (NSAIDs) Ketoprofen and Naproxen (?.Int J Mol Sci. 2019 Jun 24;20(12):3074. doi: 10.3390/ijms20123074.
31 Phenotypic and genotypic characterization Vibrio cholerae O139 of clinical and aquatic isolates in China.Curr Microbiol. 2011 Mar;62(3):950-5. doi: 10.1007/s00284-010-9802-3. Epub 2010 Nov 16.
32 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
33 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
34 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
35 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
36 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
37 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.