Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOJMWW0)

DOT Name Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)
Synonyms Collagenous repeat-containing sequence 26 kDa protein; CORS26; Secretory protein CORS26
Gene Name C1QTNF3
Related Disease
Coronary atherosclerosis ( )
Cardiovascular disease ( )
Chronic kidney disease ( )
Diabetic retinopathy ( )
High blood pressure ( )
Multiple sclerosis ( )
Non-alcoholic fatty liver disease ( )
Non-insulin dependent diabetes ( )
Osteoporosis ( )
Polycystic ovarian syndrome ( )
Proliferative diabetic retinopathy ( )
Prostate cancer ( )
Prostate carcinoma ( )
Type-1/2 diabetes ( )
Obesity ( )
Rheumatoid arthritis ( )
Arthritis ( )
Coronary heart disease ( )
UniProt ID
C1QT3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00386 ; PF01391
Sequence
MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPG
PPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAF
MASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYV
YLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGF
LLFETK
Tissue Specificity Expressed in colon and small intestine.

Molecular Interaction Atlas (MIA) of This DOT

18 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Coronary atherosclerosis DISKNDYU Definitive Biomarker [1]
Cardiovascular disease DIS2IQDX Strong Biomarker [2]
Chronic kidney disease DISW82R7 Strong Altered Expression [3]
Diabetic retinopathy DISHGUJM Strong Biomarker [4]
High blood pressure DISY2OHH Strong Altered Expression [2]
Multiple sclerosis DISB2WZI Strong Altered Expression [5]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [6]
Non-insulin dependent diabetes DISK1O5Z Strong Altered Expression [4]
Osteoporosis DISF2JE0 Strong Genetic Variation [7]
Polycystic ovarian syndrome DISZ2BNG Strong Altered Expression [8]
Proliferative diabetic retinopathy DISQZ13G Strong Biomarker [4]
Prostate cancer DISF190Y Strong Biomarker [9]
Prostate carcinoma DISMJPLE Strong Biomarker [9]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [10]
Obesity DIS47Y1K moderate Altered Expression [10]
Rheumatoid arthritis DISTSB4J moderate Altered Expression [11]
Arthritis DIST1YEL Disputed Biomarker [12]
Coronary heart disease DIS5OIP1 Limited Biomarker [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 18 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [13]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [14]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [15]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [16]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [17]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [18]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [19]
Triclosan DMZUR4N Approved Triclosan increases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [20]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [21]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [22]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [24]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3). [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 Role of CTRP3, CTRP9 and MCP-1 for the evaluation of T2DM associated coronary artery disease in Egyptian postmenopausal females.PLoS One. 2018 Dec 17;13(12):e0208038. doi: 10.1371/journal.pone.0208038. eCollection 2018.
2 Serum Levels of Complement-C1q/Tumor Necrosis Factor-Related Protein-3 Decreased in Patients With Acute Aortic Dissection.Am J Cardiol. 2018 Oct 1;122(7):1244-1248. doi: 10.1016/j.amjcard.2018.06.024. Epub 2018 Jul 4.
3 The cartonectin levels at different stages of chronic kidney disease and related factors.Ren Fail. 2019 Feb 7;41(1):42-46. doi: 10.1080/0886022X.2018.1561373. eCollection 2019.
4 CTRP3 is a novel biomarker for diabetic retinopathy and inhibits HGHL-induced VCAM-1 expression in an AMPK-dependent manner.PLoS One. 2017 Jun 20;12(6):e0178253. doi: 10.1371/journal.pone.0178253. eCollection 2017.
5 Plasma levels of CTRP-3, CTRP-9 and apelin in women with multiple sclerosis.J Neuroimmunol. 2019 Aug 15;333:576968. doi: 10.1016/j.jneuroim.2019.576968. Epub 2019 May 16.
6 Serum CTRP3 level is inversely associated with nonalcoholic fatty liver disease: A 3-y longitudinal study.Clin Chim Acta. 2018 Apr;479:79-83. doi: 10.1016/j.cca.2018.01.003. Epub 2018 Jan 3.
7 Serum CTRP3 Level is Associated with Osteoporosis in Postmenopausal Women.Exp Clin Endocrinol Diabetes. 2018 Oct;126(9):559-563. doi: 10.1055/s-0043-124365. Epub 2018 Feb 8.
8 Metformin increases the novel adipokine cartonectin/CTRP3 in women with polycystic ovary syndrome.J Clin Endocrinol Metab. 2013 Dec;98(12):E1891-900. doi: 10.1210/jc.2013-2227. Epub 2013 Oct 23.
9 RankProd Combined with Genetic Algorithm Optimized Artificial Neural Network Establishes a Diagnostic and Prognostic Prediction Model that Revealed C1QTNF3 as a Biomarker for Prostate Cancer.EBioMedicine. 2018 Jun;32:234-244. doi: 10.1016/j.ebiom.2018.05.010. Epub 2018 Jun 1.
10 Decreased CTRP3 Plasma Concentrations Are Associated with Sepsis and Predict Mortality in Critically Ill Patients.Diagnostics (Basel). 2019 Jun 21;9(2):63. doi: 10.3390/diagnostics9020063.
11 Investigation of gene expression profiles in a rat adjuvant arthritis model suggests an effective role of triptolide via PI3K-AKT signaling.Exp Ther Med. 2019 May;17(5):3999-4006. doi: 10.3892/etm.2019.7425. Epub 2019 Mar 20.
12 CTRP3 plays an important role in the development of collagen-induced arthritis in mice.Biochem Biophys Res Commun. 2014 Jan 3;443(1):42-8. doi: 10.1016/j.bbrc.2013.11.040. Epub 2013 Nov 20.
13 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
14 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
15 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
16 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
17 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
18 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
19 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
20 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
21 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
22 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
23 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
24 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
25 Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.