Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOLE1FT)

• DOT Name: Rho-related GTP-binding protein RhoC (RHOC)
• Synonyms: Rho cDNA clone 9; h9
• Gene Name: RHOC
• Related Disease:
  Gastric neoplasm
  Squamous cell carcinoma
  Anemia
  Breast neoplasm
  Cholangiocarcinoma
  Colorectal carcinoma
  Endometrial carcinoma
  Endometriosis
  Endometrium adenocarcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Melanoma
  Myocardial ischemia
  Neoplasm
  Ovarian cancer
  Pancreatic adenocarcinoma
  Pancreatic cancer
  Pancreatic ductal carcinoma
  Pancreatic tumour
  Prostate neoplasm
  Systemic sclerosis
  Adult glioblastoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Glioblastoma multiforme
  Inflammatory breast cancer
  Advanced cancer
  Metastatic malignant neoplasm
• UniProt ID: RHOC_HUMAN
• PDB ID: 1Z2C; 2GCN; 2GCO; 2GCP
• Pfam ID: PF00071
• Sequence:
  MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT
  AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
  LRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
  VRKNKRRRGCPIL
• Function: Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.
• Reactome Pathway:
  Sema4D induced cell migration and growth-cone collapse (R-HSA-416572)
  RHO GTPases activate PKNs (R-HSA-5625740)
  RHO GTPases activate CIT (R-HSA-5625900)
  RHO GTPases Activate ROCKs (R-HSA-5627117)
  RHO GTPases Activate Formins (R-HSA-5663220)
  RHO GTPases Activate Rhotekin and Rhophilins (R-HSA-5666185)
  RHOC GTPase cycle (R-HSA-9013106)
  G alpha (12/13) signalling events (R-HSA-416482)

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric neoplasm	DISOKN4Y	Definitive	Biomarker	[1]
Squamous cell carcinoma	DISQVIFL	Definitive	Altered Expression	[2]
Anemia	DISTVL0C	Strong	Biomarker	[3]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[4]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[6]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[7]
Endometriosis	DISX1AG8	Strong	Biomarker	[8]
Endometrium adenocarcinoma	DISY6744	Strong	Altered Expression	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[2]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
Melanoma	DIS1RRCY	Strong	Altered Expression	[12]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Altered Expression	[14]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[15]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Altered Expression	[16]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[17]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Genetic Variation	[17]
Pancreatic tumour	DIS3U0LK	Strong	Altered Expression	[16]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[18]
Systemic sclerosis	DISF44L6	Strong	Genetic Variation	[19]
Adult glioblastoma	DISVP4LU	moderate	Altered Expression	[20]
Breast cancer	DIS7DPX1	moderate	Altered Expression	[21]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[21]
Carcinoma	DISH9F1N	moderate	Altered Expression	[22]
Cervical carcinoma	DIST4S00	moderate	Altered Expression	[23]
Colon cancer	DISVC52G	moderate	Biomarker	[24]
Colon carcinoma	DISJYKUO	moderate	Altered Expression	[24]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[20]
Inflammatory breast cancer	DIS3QRWA	moderate	Biomarker	[25]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[21]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[21]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[26]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[27]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[28]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[29]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[30]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Rho-related GTP-binding protein RhoC (RHOC).	[31]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[32]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[33]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[34]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Rho-related GTP-binding protein RhoC (RHOC).	[31]
Marinol	DM70IK5	Approved	Marinol increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[35]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Rho-related GTP-binding protein RhoC (RHOC).	[37]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[38]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[39]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[40]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[41]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[43]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[45]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[33]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[48]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[49]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[50]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide decreases the expression of Rho-related GTP-binding protein RhoC (RHOC).	[51]
LPA	DMI5XR1	Investigative	LPA increases the activity of Rho-related GTP-binding protein RhoC (RHOC).	[52]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Zoledronate	DMIXC7G	Approved	Zoledronate affects the localization of Rho-related GTP-binding protein RhoC (RHOC).	[36]
Terbinafine	DMI6HUW	Approved	Terbinafine increases the localization of Rho-related GTP-binding protein RhoC (RHOC).	[42]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the localization of Rho-related GTP-binding protein RhoC (RHOC).	[44]

References

• [1] RhoC is essential for the metastasis of gastric cancer.J Mol Med (Berl). 2007 Oct;85(10):1149-56. doi: 10.1007/s00109-007-0217-y. Epub 2007 Jun 5.
• [2] Clinical and prognostic significance of RhoA and RhoC gene expression in esophageal squamous cell carcinoma.Ann Surg Oncol. 2007 Dec;14(12):3593-601. doi: 10.1245/s10434-007-9562-x. Epub 2007 Sep 25.
• [3] Gene expression profiles associated with anaemia and ITPA genotypes in patients with chronic hepatitis C (CH-C).J Viral Hepat. 2012 Jun;19(6):414-22. doi: 10.1111/j.1365-2893.2011.01564.x. Epub 2011 Dec 7.
• [4] Molecular epidemiologic features of inflammatory breast cancer: a comparison between Egyptian and US patients.Breast Cancer Res Treat. 2008 Nov;112(1):141-7. doi: 10.1007/s10549-007-9833-z. Epub 2007 Dec 4.
• [5] HOXD10 acts as a tumor-suppressive factor via inhibition of the RHOC/AKT/MAPK pathway in human cholangiocellular carcinoma.Oncol Rep. 2015 Oct;34(4):1681-91. doi: 10.3892/or.2015.4194. Epub 2015 Aug 10.
• [6] Biological Characteristics and Clinical Significance of ITGB1 and RHOC in Patients With Recurrent Colorectal Cancer.Anticancer Res. 2019 Sep;39(9):4853-4864. doi: 10.21873/anticanres.13671.
• [7] MicroRNA-372 inhibits endometrial carcinoma development by targeting the expression of the Ras homolog gene family member C (RhoC).Oncotarget. 2016 Feb 9;7(6):6649-64. doi: 10.18632/oncotarget.6544.
• [8] RHOC: a key gene for endometriosis.Reprod Sci. 2013 Aug;20(8):998-1002. doi: 10.1177/1933719112472743. Epub 2013 Jan 9.
• [9] Inhibition of Ovarian Epithelial Carcinoma Tumorigenesis and Progression by microRNA 106b Mediated through the RhoC Pathway.PLoS One. 2015 May 1;10(5):e0125714. doi: 10.1371/journal.pone.0125714. eCollection 2015.
• [10] RhoC expression and head and neck cancer metastasis.Mol Cancer Res. 2009 Nov;7(11):1771-80. doi: 10.1158/1541-7786.MCR-08-0512. Epub 2009 Oct 27.
• [11] RhoC is essential for angiogenesis induced by hepatocellular carcinoma cells via regulation of endothelial cell organization.Cancer Sci. 2008 Oct;99(10):2012-8. doi: 10.1111/j.1349-7006.2008.00902.x.
• [12] Suppression subtractive hybridization profiles of radial growth phase and metastatic melanoma cell lines reveal novel potential targets.BMC Cancer. 2008 Jan 22;8:19. doi: 10.1186/1471-2407-8-19.
• [13] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [14] Effect of RhoC silencing on multiple myeloma xenografts and angiogenesis in nude mice.J Biol Regul Homeost Agents. 2019 September-October,;33(5):1387-1394.
• [15] The role of RhoC in ovarian epithelial carcinoma: a marker for carcinogenesis, progression, prognosis, and target therapy.Gynecol Oncol. 2013 Sep;130(3):570-8. doi: 10.1016/j.ygyno.2013.06.004. Epub 2013 Jun 10.
• [16] Regulation of pancreatic cancer cell migration and invasion by RhoC GTPase and caveolin-1.Mol Cancer. 2005 Jun 21;4(1):21. doi: 10.1186/1476-4598-4-21.
• [17] Overexpression of the rhoC gene correlates with progression of ductal adenocarcinoma of the pancreas.Br J Cancer. 1998;77(1):147-52. doi: 10.1038/bjc.1998.23.
• [18] RhoC promotes metastasis via activation of the Pyk2 pathway in prostate cancer.Cancer Res. 2008 Sep 15;68(18):7613-20. doi: 10.1158/0008-5472.CAN-07-6700.
• [19] Investigation of the association between Rho/Rho-kinase gene polymorphisms and systemic sclerosis.Rheumatol Int. 2016 Mar;36(3):421-7. doi: 10.1007/s00296-015-3400-4. Epub 2015 Nov 28.
• [20] The Role of RhoA, RhoB and RhoC GTPases in Cell Morphology, Proliferation and Migration in Human Cytomegalovirus (HCMV) Infected Glioblastoma Cells.Cell Physiol Biochem. 2016;38(1):94-109. doi: 10.1159/000438612. Epub 2016 Jan 8.
• [21] Synergistic inhibition of aggressive breast cancer cell migration and invasion by cytoplasmic delivery of anti-RhoC silencing RNA and presentation of EPPT1 peptide on "smart" particles.J Control Release. 2018 Nov 10;289:79-93. doi: 10.1016/j.jconrel.2018.07.042. Epub 2018 Aug 24.
• [22] Ovarian clear cell carcinomas: RHO GTPases may contribute to explain their singular biologic behavior.Hum Pathol. 2011 Jun;42(6):833-9. doi: 10.1016/j.humpath.2010.08.022. Epub 2011 Jan 3.
• [23] Notch1 regulates the functional contribution of RhoC to cervical carcinoma progression.Br J Cancer. 2010 Jan 5;102(1):196-205. doi: 10.1038/sj.bjc.6605451. Epub 2009 Dec 1.
• [24] Epigenetic inactivation of HOXD10 is associated with human colon cancer via inhibiting the RHOC/AKT/MAPK signaling pathway.Cell Commun Signal. 2019 Jan 25;17(1):9. doi: 10.1186/s12964-018-0316-0.
• [25] Macrophages Enhance Migration in Inflammatory Breast Cancer Cells via RhoC GTPase Signaling.Sci Rep. 2016 Dec 19;6:39190. doi: 10.1038/srep39190.
• [26] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [27] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [28] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [29] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [30] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [31] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [32] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [33] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [34] Grouping of histone deacetylase inhibitors and other toxicants disturbing neural crest migration by transcriptional profiling. Neurotoxicology. 2015 Sep;50:56-70.
• [35] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [36] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [37] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [38] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [39] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [40] Cytoskeletal activation and altered gene expression in endothelial barrier regulation by simvastatin. Am J Respir Cell Mol Biol. 2004 May;30(5):662-70. doi: 10.1165/rcmb.2003-0267OC. Epub 2003 Nov 20.
• [41] N-acylation of glucosamine modulates chondrocyte growth, proteoglycan synthesis, and gene expression. J Rheumatol. 2005 Sep;32(9):1775-86.
• [42] Terbinafine inhibits endothelial cell migration through suppression of the Rho-mediated pathway. Mol Cancer Ther. 2006 Dec;5(12):3130-8. doi: 10.1158/1535-7163.MCT-06-0457.
• [43] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [44] Combination of atorvastatin and celecoxib synergistically induces cell cycle arrest and apoptosis in colon cancer cells. Int J Cancer. 2008 May 1;122(9):2115-24. doi: 10.1002/ijc.23315.
• [45] MIP-1beta, a novel biomarker for in vitro sensitization test using human monocytic cell line. Toxicol In Vitro. 2006 Aug;20(5):736-42.
• [46] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [49] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [50] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [51] RNF168 suppresses the cancer stem cell-like traits of nonsmall cell lung cancer cells by mediating RhoC ubiquitination. Environ Toxicol. 2022 Mar;37(3):603-611. doi: 10.1002/tox.23428. Epub 2021 Dec 7.
• [52] Use of synthetic isoprenoids to target protein prenylation and Rho GTPases in breast cancer invasion. PLoS One. 2014 Feb 26;9(2):e89892. doi: 10.1371/journal.pone.0089892. eCollection 2014.