Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPTMHIV)

• DOT Name: Cyclin-dependent kinases regulatory subunit 2 (CKS2)
• Synonyms: CKS-2
• Gene Name: CKS2
• Related Disease:
  Meningioma
  Advanced cancer
  Bladder cancer
  Carcinoma
  Carcinoma of esophagus
  Cervical cancer
  Cervical carcinoma
  Cholangiocarcinoma
  Colorectal carcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Gastric cancer
  Hepatocellular carcinoma
  Metastatic malignant neoplasm
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate neoplasm
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Uterine fibroids
  Laryngeal squamous cell carcinoma
  Liver cirrhosis
  Acute lymphocytic leukaemia
  Breast cancer
  Breast carcinoma
  Childhood acute lymphoblastic leukemia
  T-cell acute lymphoblastic leukaemia
  Thyroid gland papillary carcinoma
• UniProt ID: CKS2_HUMAN
• PDB ID: 1CKS; 4Y72; 4YC3; 5HQ0; 5LQF; 6GU2; 6GU3; 6GU4; 6GU6; 6GU7
• Pfam ID: PF01111
• Sequence:
  MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH
  EPEPHILLFRRPLPKDQQK
• Function: Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
• KEGG Pathway:
  Pathways in cancer (hsa05200)
  Small cell lung cancer (hsa05222)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Meningioma	DISPT4TG	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Bladder cancer	DISUHNM0	Strong	Biomarker	[3]
Carcinoma	DISH9F1N	Strong	Biomarker	[4]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[5]
Cervical cancer	DISFSHPF	Strong	Biomarker	[6]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[6]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[10]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[12]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[12]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[13]
Prostate cancer	DISF190Y	Strong	Altered Expression	[14]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[14]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[11]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[3]
Uterine fibroids	DISBZRMJ	Strong	Biomarker	[15]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Biomarker	[16]
Liver cirrhosis	DIS4G1GX	moderate	Altered Expression	[12]
Acute lymphocytic leukaemia	DISPX75S	Limited	Altered Expression	[17]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[2]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Limited	Altered Expression	[17]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Limited	Altered Expression	[17]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Altered Expression	[18]

38 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[19]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[20]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[24]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[25]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[26]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[27]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[27]
Marinol	DM70IK5	Approved	Marinol increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[28]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[29]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[30]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[31]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[32]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[30]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[33]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[34]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[35]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[36]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[37]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[30]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[38]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[39]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[40]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[41]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[42]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[46]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[47]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[25]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[48]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[49]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[50]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[51]
Manganese	DMKT129	Investigative	Manganese decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[52]
ORG2058	DMH1M6N	Investigative	ORG2058 decreases the expression of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[53]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cyclin-dependent kinases regulatory subunit 2 (CKS2).	[43]

References

• [1] Genetic alterations associated with progression and recurrence in meningiomas.J Neuropathol Exp Neurol. 2012 Oct;71(10):882-93. doi: 10.1097/NEN.0b013e31826bf704.
• [2] Overexpression of CKS2 is associated with a poor prognosis and promotes cell proliferation and invasion in breast cancer.Mol Med Rep. 2019 Jun;19(6):4761-4769. doi: 10.3892/mmr.2019.10134. Epub 2019 Apr 5.
• [3] Cyclin-dependent kinase-associated protein Cks2 is associated with bladder cancer progression.J Int Med Res. 2011;39(2):533-40. doi: 10.1177/147323001103900222.
• [4] Clinical significance and expression of cyclin kinase subunits 1 and 2 in hepatocellular carcinoma.Liver Int. 2010 Jan;30(1):119-25. doi: 10.1111/j.1478-3231.2009.02106.x. Epub 2009 Oct 21.
• [5] Clinical significance of overexpressed cyclin-dependent kinase subunits 1 and 2 in esophageal carcinoma.Dis Esophagus. 2013 Sep-Oct;26(7):729-36. doi: 10.1111/dote.12013. Epub 2013 Jan 10.
• [6] Mitochondrial Function of CKS2 Oncoprotein Links Oxidative Phosphorylation with Cell Division in Chemoradioresistant Cervical Cancer.Neoplasia. 2019 Apr;21(4):353-362. doi: 10.1016/j.neo.2019.01.002. Epub 2019 Mar 8.
• [7] Oncogenic potential of cyclin kinase subunit-2 in cholangiocarcinoma.Liver Int. 2013 Jan;33(1):137-48. doi: 10.1111/liv.12014. Epub 2012 Nov 1.
• [8] New Wnt/-catenin target genes promote experimental metastasis and migration of colorectal cancer cells through different signals.Gut. 2016 Oct;65(10):1690-701. doi: 10.1136/gutjnl-2014-307900. Epub 2015 Jul 8.
• [9] CKS2 promotes tumor progression and metastasis and is an independent predictor of poor prognosis in epithelial ovarian cancer.Eur Rev Med Pharmacol Sci. 2019 Apr;23(8):3225-3234. doi: 10.26355/eurrev_201904_17681.
• [10] Clinical and biological impact of cyclin-dependent kinase subunit 2 in esophageal squamous cell carcinoma.Oncol Rep. 2014 May;31(5):1986-92. doi: 10.3892/or.2014.3062. Epub 2014 Mar 5.
• [11] Clinicopathological and biological significance of CDC28 protein kinase regulatory subunit 2 overexpression in human gastric cancer.Int J Oncol. 2011 Aug;39(2):361-72. doi: 10.3892/ijo.2011.1056. Epub 2011 May 25.
• [12] Cyclin-Dependent Kinase Regulatory Subunit 2 Indicated Poor Prognosis and Facilitated Aggressive Phenotype of Hepatocellular Carcinoma.Dis Markers. 2019 Oct 22;2019:8964015. doi: 10.1155/2019/8964015. eCollection 2019.
• [13] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [14] Aberrant expression of Cks1 and Cks2 contributes to prostate tumorigenesis by promoting proliferation and inhibiting programmed cell death.Int J Cancer. 2008 Aug 1;123(3):543-51. doi: 10.1002/ijc.23548.
• [15] Cyclin-dependent kinase subunit 2 overexpression promotes tumor progression and predicts poor prognosis in uterine leiomyosarcoma.Oncol Lett. 2019 Sep;18(3):2845-2852. doi: 10.3892/ol.2019.10668. Epub 2019 Jul 25.
• [16] MicroRNA-26a inhibits proliferation and tumorigenesis via targeting CKS2 in laryngeal squamous cell carcinoma.Clin Exp Pharmacol Physiol. 2018 May;45(5):444-451. doi: 10.1111/1440-1681.12890. Epub 2018 Jan 8.
• [17] ckshs expression is linked to cell proliferation in normal and malignant human lymphoid cells.Int J Cancer. 1999 Jul 2;82(1):98-104. doi: 10.1002/(sici)1097-0215(19990702)82:1<98::aid-ijc17>3.0.co;2-a.
• [18] miR-26a and its target CKS2 modulate cell growth and tumorigenesis of papillary thyroid carcinoma.PLoS One. 2013 Jul 5;8(7):e67591. doi: 10.1371/journal.pone.0067591. Print 2013.
• [19] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [20] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [21] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [22] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [25] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [26] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [27] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [28] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [29] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [30] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [31] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [32] Analysis of gene expression induced by diethylstilbestrol (DES) in human primitive Mullerian duct cells using microarray. Cancer Lett. 2005 Apr 8;220(2):197-210.
• [33] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [34] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [35] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [36] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [37] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [38] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [39] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [40] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [41] Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
• [42] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [47] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [48] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [49] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [50] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [51] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [52] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [53] The antiproliferative effects of progestins in T47D breast cancer cells are tempered by progestin induction of the ETS transcription factor Elf5. Mol Endocrinol. 2010 Jul;24(7):1380-92. doi: 10.1210/me.2009-0516. Epub 2010 Jun 2.