Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR0705Z)

• DOT Name: AF4/FMR2 family member 3 (AFF3)
• Synonyms: Lymphoid nuclear protein related to AF4; Protein LAF-4
• Gene Name: AFF3
• Related Disease:
  Chronic renal failure
  Acute leukaemia
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Coeliac disease
  Diabetic retinopathy
  Drug dependence
  Gastroesophageal reflux disease
  Intellectual disability
  Juvenile idiopathic arthritis
  KINSSHIP syndrome
  Leukemia
  Mesomelic dysplasia
  Multiple sclerosis
  Neoplasm
  Schizophrenia
  Substance abuse
  Substance dependence
  Systemic lupus erythematosus
  Type-1 diabetes
  Acute myelogenous leukaemia
  Immune system disorder
  Neurodevelopmental disorder
  End-stage renal disease
  Psoriatic arthritis
  Acute lymphocytic leukaemia
  Autoimmune disease
  Breast neoplasm
  Childhood acute lymphoblastic leukemia
  Follicular lymphoma
  Rheumatoid arthritis
  T-cell acute lymphoblastic leukaemia
• UniProt ID: AFF3_HUMAN
• Pfam ID: PF05110 ; PF18875 ; PF18876
• Sequence:
  MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTN
  KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQN
  QPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
  PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDG
  QDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAKLSKFSIPKQGEESRSGETNS
  CVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGT
  SNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRTSVPSSKGSSSSSSSG
  SSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKP
  PILIQNESHGSESNQYYNPVKEDVQDCGKVPDVCQPSLREKEIKSTCKEEQRPRTANKAP
  GSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGA
  NCHRPEEPAAADALGTSVVVPPEPTKTRPCGNNRASHRKELRSSVTCEKRRTRGLSRIVP
  KSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASASSGNDQRLKEAAANGGSGPR
  APVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEIRSLWVKIDLTLLSRIPE
  HLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKSQGEKD
  SSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSS
  RPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGH
  RDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQ
  GPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKR
  DHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPASSVGSQGSLSNAS
  ALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVT
  LHSSMEHLVQYSQQGLHWLRNSAHLS
• Function: Putative transcription activator that may function in lymphoid development and oncogenesis. Binds, in vitro, to double-stranded DNA.
• Tissue Specificity: Preferentially expressed in lymphoid tissues, highest levels being found in the thymus.

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic renal failure	DISGG7K6	Definitive	Genetic Variation	[1]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[4]
Coeliac disease	DISIY60C	Strong	Genetic Variation	[5]
Diabetic retinopathy	DISHGUJM	Strong	Biomarker	[6]
Drug dependence	DIS9IXRC	Strong	Biomarker	[7]
Gastroesophageal reflux disease	DISQ8G5S	Strong	Genetic Variation	[8]
Intellectual disability	DISMBNXP	Strong	Genetic Variation	[9]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Genetic Variation	[10]
KINSSHIP syndrome	DISPRXPD	Strong	Autosomal dominant	[11]
Leukemia	DISNAKFL	Strong	Biomarker	[12]
Mesomelic dysplasia	DISKJI1E	Strong	Biomarker	[13]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[14]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[15]
Substance abuse	DIS327VW	Strong	Biomarker	[7]
Substance dependence	DISDRAAR	Strong	Biomarker	[7]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[16]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[17]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[18]
Immune system disorder	DISAEGPH	moderate	Genetic Variation	[19]
Neurodevelopmental disorder	DIS372XH	moderate	Biomarker	[9]
End-stage renal disease	DISXA7GG	Disputed	Genetic Variation	[20]
Psoriatic arthritis	DISLWTG2	Disputed	Genetic Variation	[21]
Acute lymphocytic leukaemia	DISPX75S	Limited	Biomarker	[22]
Autoimmune disease	DISORMTM	Limited	Altered Expression	[23]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[4]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Limited	Biomarker	[22]
Follicular lymphoma	DISVEUR6	Limited	Genetic Variation	[24]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[5]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Limited	Genetic Variation	[2]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of AF4/FMR2 family member 3 (AFF3).	[25]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of AF4/FMR2 family member 3 (AFF3).	[26]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of AF4/FMR2 family member 3 (AFF3).	[27]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of AF4/FMR2 family member 3 (AFF3).	[28]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of AF4/FMR2 family member 3 (AFF3).	[29]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of AF4/FMR2 family member 3 (AFF3).	[30]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of AF4/FMR2 family member 3 (AFF3).	[31]
Marinol	DM70IK5	Approved	Marinol increases the expression of AF4/FMR2 family member 3 (AFF3).	[32]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of AF4/FMR2 family member 3 (AFF3).	[33]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of AF4/FMR2 family member 3 (AFF3).	[34]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of AF4/FMR2 family member 3 (AFF3).	[34]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of AF4/FMR2 family member 3 (AFF3).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of AF4/FMR2 family member 3 (AFF3).	[37]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of AF4/FMR2 family member 3 (AFF3).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of AF4/FMR2 family member 3 (AFF3).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of AF4/FMR2 family member 3 (AFF3).	[41]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of AF4/FMR2 family member 3 (AFF3).	[42]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of AF4/FMR2 family member 3 (AFF3).	[35]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of AF4/FMR2 family member 3 (AFF3).	[38]

References

• [1] The Genetic Landscape of Renal Complications in Type 1 Diabetes.J Am Soc Nephrol. 2017 Feb;28(2):557-574. doi: 10.1681/ASN.2016020231. Epub 2016 Sep 19.
• [2] Identification of the novel AML1 fusion partner gene, LAF4, a fusion partner of MLL, in childhood T-cell acute lymphoblastic leukemia with t(2;21)(q11;q22) by bubble PCR method for cDNA.Oncogene. 2008 Apr 3;27(15):2249-56. doi: 10.1038/sj.onc.1210857. Epub 2007 Oct 29.
• [3] Gene structure and subcellular localization of FMR2, a member of a new family of putative transcription activators.Genomics. 1997 Sep 1;44(2):201-13. doi: 10.1006/geno.1997.4867.
• [4] AFF3 upregulation mediates tamoxifen resistance in breast cancers.J Exp Clin Cancer Res. 2018 Oct 16;37(1):254. doi: 10.1186/s13046-018-0928-7.
• [5] Functional implications of disease-specific variants in loci jointly associated with coeliac disease and rheumatoid arthritis.Hum Mol Genet. 2016 Jan 1;25(1):180-90. doi: 10.1093/hmg/ddv455. Epub 2015 Nov 5.
• [6] Progress in Defining the Genetic Basis of Diabetic Complications.Curr Diab Rep. 2017 Sep;17(9):80. doi: 10.1007/s11892-017-0906-z.
• [7] Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
• [8] Gastroesophageal reflux GWAS identifies risk loci that also associate with subsequent severe esophageal diseases.Nat Commun. 2019 Sep 16;10(1):4219. doi: 10.1038/s41467-019-11968-2.
• [9] Laf4/Aff3, a gene involved in intellectual disability, is required for cellular migration in the mouse cerebral cortex.PLoS One. 2014 Aug 27;9(8):e105933. doi: 10.1371/journal.pone.0105933. eCollection 2014.
• [10] Association of the AFF3 gene and IL2/IL21 gene region with juvenile idiopathic arthritis.Genes Immun. 2010 Mar;11(2):194-8. doi: 10.1038/gene.2009.105. Epub 2010 Jan 14.
• [11] Triangular tibia with fibular aplasia associated with a microdeletion on 2q11.2 encompassing LAF4. Clin Genet. 2008 Dec;74(6):560-5. doi: 10.1111/j.1399-0004.2008.01050.x. Epub 2008 Jun 23.
• [12] LAF-4 encodes a lymphoid nuclear protein with transactivation potential that is homologous to AF-4, the gene fused to MLL in t(4;11) leukemias.Blood. 1996 Jan 15;87(2):734-45.
• [13] De novo AFF3 variant in a patient with mesomelic dysplasia with foot malformation.J Hum Genet. 2019 Oct;64(10):1041-1044. doi: 10.1038/s10038-019-0650-0. Epub 2019 Aug 6.
• [14] Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.Ann Neurol. 2011 Dec;70(6):897-912. doi: 10.1002/ana.22609.
• [15] Pleiotropic Meta-Analysis of Cognition, Education, and Schizophrenia Differentiates Roles of Early Neurodevelopmental and Adult Synaptic Pathways.Am J Hum Genet. 2019 Aug 1;105(2):334-350. doi: 10.1016/j.ajhg.2019.06.012.
• [16] Association of AFF1 rs340630 and AFF3 rs10865035 polymorphisms with systemic lupus erythematosus in a Chinese population.Immunogenetics. 2012 Dec;64(12):935-8. doi: 10.1007/s00251-012-0650-0. Epub 2012 Sep 16.
• [17] Fine mapping of type 1 diabetes susceptibility loci and evidence for colocalization of causal variants with lymphoid gene enhancers.Nat Genet. 2015 Apr;47(4):381-6. doi: 10.1038/ng.3245. Epub 2015 Mar 9.
• [18] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [19] Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.PLoS Genet. 2011 Feb;7(2):e1002004. doi: 10.1371/journal.pgen.1002004. Epub 2011 Feb 24.
• [20] Replication study for the association of 3 SNP loci identified in a genome-wide association study for diabetic nephropathy in European type 1 diabetes with diabetic nephropathy in Japanese patients with type 2 diabetes.Clin Exp Nephrol. 2013 Dec;17(6):866-71. doi: 10.1007/s10157-013-0797-5. Epub 2013 Mar 30.
• [21] Comprehensive assessment of rheumatoid arthritis susceptibility loci in a large psoriatic arthritis cohort.Ann Rheum Dis. 2012 Aug;71(8):1350-4. doi: 10.1136/annrheumdis-2011-200802. Epub 2012 Feb 10.
• [22] LAF-4 is aberrantly expressed in human breast cancer.Int J Cancer. 2005 Jul 1;115(4):568-74. doi: 10.1002/ijc.20881.
• [23] Persistent coxsackievirus B4 infection induces microRNA dysregulation in human pancreatic cells.Cell Mol Life Sci. 2017 Oct;74(20):3851-3861. doi: 10.1007/s00018-017-2567-0. Epub 2017 Jun 10.
• [24] A novel fusion 5'AFF3/3'BCL2 originated from a t(2;18)(q11.2;q21.33) translocation in follicular lymphoma.Oncogene. 2008 Oct 16;27(47):6187-90. doi: 10.1038/onc.2008.214. Epub 2008 Jul 14.
• [25] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [26] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [27] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [28] Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
• [29] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [30] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [31] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [32] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [33] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [34] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [39] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [40] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [42] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.