Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWBR27Y)

• DOT Name: Collagen alpha-1(IX) chain (COL9A1)
• Synonyms: Collagen alpha-1(IX) chain
• Gene Name: COL9A1
• Related Disease:
  Epiphyseal dysplasia, multiple, 6
  Metabolic disorder
  Nervous system disease
  Stickler syndrome, type 4
  Advanced cancer
  Alpha thalassemia
  Atrial fibrillation
  Bone osteosarcoma
  Chronic kidney disease
  Depression
  Diastrophic dysplasia
  Familial hypercholesterolemia
  Familial Mediterranean fever
  Hypercholesterolemia, familial, 1
  Hyperostosis corticalis generalisata
  Malignant soft tissue neoplasm
  Medulloblastoma
  Melnick-Needles syndrome
  Myopia
  Neoplasm
  Non-insulin dependent diabetes
  Osteoarthritis
  Osteochondrodysplasia
  Osteosarcoma
  Postmenopausal osteoporosis
  Retinopathy
  Sarcoma
  Schwartz-Jampel syndrome
  Schwartz-Jampel syndrome type 1
  Sensorineural hearing loss disorder
  Spondyloepiphyseal dysplasia
  Spondyloepiphyseal dysplasia tarda, X-linked
  Stickler syndrome type 1
  Triple negative breast cancer
  High blood pressure
  Multiple epiphyseal dysplasia due to collagen 9 anomaly
  Obsolete autosomal recessive Stickler syndrome
  Clubfoot
  Asthma
  Bone development disease
  Cardiovascular disease
  Glioma
  Multiple epiphyseal dysplasia
  Pancreatic ductal carcinoma
  Pseudoachondroplasia
  Stickler syndrome
• UniProt ID: CO9A1_HUMAN
• PDB ID: 2UUR; 5CTD; 5CTI; 5CVA; 5CVB
• Pfam ID: PF01391
• Sequence:
  MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLI
  SQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMT
  GSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQW
  HKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLI
  HCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
  PGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIP
  GPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRS
  GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDK
  GEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLP
  GVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQM
  GNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLP
  GMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGLRGPEGSR
  GLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAAS
  LKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK
  GERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGF
  CEPASCTMQAGQRAFNKGPDP
• Function: Structural component of hyaline cartilage and vitreous of the eye.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Cytoskeleton in muscle cells (hsa04820)
  Protein digestion and absorption (hsa04974)
  Human papillomavirus infection (hsa05165)
• Reactome Pathway:
  Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
  Signaling by PDGF (R-HSA-186797)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Integrin cell surface interactions (R-HSA-216083)
  ECM proteoglycans (R-HSA-3000178)
  NCAM1 interactions (R-HSA-419037)
  Collagen chain trimerization (R-HSA-8948216)
  Collagen degradation (R-HSA-1442490)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epiphyseal dysplasia, multiple, 6	DISDBTYN	Definitive	Autosomal dominant	[1]
Metabolic disorder	DIS71G5H	Definitive	Biomarker	[2]
Nervous system disease	DISJ7GGT	Definitive	Genetic Variation	[3]
Stickler syndrome, type 4	DISGMI32	Definitive	Autosomal recessive	[4]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[5]
Alpha thalassemia	DIS5XGK0	Strong	Genetic Variation	[6]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[7]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[8]
Chronic kidney disease	DISW82R7	Strong	Altered Expression	[9]
Depression	DIS3XJ69	Strong	Biomarker	[10]
Diastrophic dysplasia	DISNTGP7	Strong	Biomarker	[11]
Familial hypercholesterolemia	DISC06IX	Strong	Genetic Variation	[2]
Familial Mediterranean fever	DISVP5WP	Strong	Genetic Variation	[12]
Hypercholesterolemia, familial, 1	DISU411W	Strong	Biomarker	[13]
Hyperostosis corticalis generalisata	DISR4BHB	Strong	Biomarker	[4]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Altered Expression	[14]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[15]
Melnick-Needles syndrome	DIS0KTGM	Strong	Biomarker	[4]
Myopia	DISK5S60	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[17]
Osteoarthritis	DIS05URM	Strong	Posttranslational Modification	[18]
Osteochondrodysplasia	DIS9SPWW	Strong	Biomarker	[4]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[8]
Postmenopausal osteoporosis	DISS0RQZ	Strong	Genetic Variation	[19]
Retinopathy	DISB4B0F	Strong	Biomarker	[4]
Sarcoma	DISZDG3U	Strong	Altered Expression	[14]
Schwartz-Jampel syndrome	DIS3HCR8	Strong	Biomarker	[4]
Schwartz-Jampel syndrome type 1	DIS42TKQ	Strong	Biomarker	[4]
Sensorineural hearing loss disorder	DISJV45Z	Strong	Biomarker	[4]
Spondyloepiphyseal dysplasia	DIS1JG9A	Strong	Biomarker	[4]
Spondyloepiphyseal dysplasia tarda, X-linked	DIS9EL3M	Strong	Biomarker	[4]
Stickler syndrome type 1	DIST5L4S	Strong	Biomarker	[20]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[16]
High blood pressure	DISY2OHH	moderate	Biomarker	[21]
Multiple epiphyseal dysplasia due to collagen 9 anomaly	DISH640Y	Supportive	Autosomal dominant	[22]
Obsolete autosomal recessive Stickler syndrome	DISCSIL9	Supportive	Autosomal recessive	[23]
Clubfoot	DISLXT4S	Disputed	Genetic Variation	[24]
Asthma	DISW9QNS	Limited	Biomarker	[25]
Bone development disease	DISVKAZS	Limited	Biomarker	[26]
Cardiovascular disease	DIS2IQDX	Limited	Biomarker	[17]
Glioma	DIS5RPEH	Limited	Biomarker	[27]
Multiple epiphyseal dysplasia	DIS5FZLR	Limited	Genetic Variation	[20]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Genetic Variation	[28]
Pseudoachondroplasia	DISVJW4A	Limited	Genetic Variation	[29]
Stickler syndrome	DISQWFHN	Limited	Autosomal recessive	[30]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Collagen alpha-1(IX) chain (COL9A1).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[34]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[35]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Collagen alpha-1(IX) chain (COL9A1).	[36]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Collagen alpha-1(IX) chain (COL9A1).	[37]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[38]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Collagen alpha-1(IX) chain (COL9A1).	[42]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Collagen alpha-1(IX) chain (COL9A1).	[40]

References

• [1] A mutation in COL9A1 causes multiple epiphyseal dysplasia: further evidence for locus heterogeneity. Am J Hum Genet. 2001 Nov;69(5):969-80. doi: 10.1086/324023. Epub 2001 Sep 14.
• [2] Diagnosis of families with familial hypercholesterolaemia and/or Apo B-100 defect by means of DNA analysis of LDL-receptor gene mutations.J Inherit Metab Dis. 2007 Apr;30(2):239-47. doi: 10.1007/s10545-007-0563-5. Epub 2007 Mar 8.
• [3] MED23 mutation links intellectual disability to dysregulation of immediate early gene expression. Science. 2011 Aug 26;333(6046):1161-3. doi: 10.1126/science.1206638.
• [4] A new autosomal recessive form of Stickler syndrome is caused by a mutation in the COL9A1 gene. Am J Hum Genet. 2006 Sep;79(3):449-57. doi: 10.1086/506478. Epub 2006 Jun 26.
• [5] Variants in FAT1 and COL9A1 genes in male population with or without substance use to assess the risk factors for oral malignancy.PLoS One. 2019 Jan 18;14(1):e0210901. doi: 10.1371/journal.pone.0210901. eCollection 2019.
• [6] Identification of -globin chain variants: a report from Iran.Arch Iran Med. 2012 Sep;15(9):564-7.
• [7] Prevalence and Incidence of Atrial Fibrillation in the General Population Based on National Health Insurance Special Health Checkups- TAMA MED Project-AF.Circ J. 2019 Feb 25;83(3):524-531. doi: 10.1253/circj.CJ-18-1038. Epub 2019 Jan 11.
• [8] Gene expression profile of the whole Mediator complex in human osteosarcoma and normal osteoblasts.Med Oncol. 2013 Dec;30(4):739. doi: 10.1007/s12032-013-0739-9. Epub 2013 Oct 8.
• [9] Serum protease activity in chronic kidney disease patients: The GANI_MED renal cohort.Exp Biol Med (Maywood). 2017 Mar;242(5):554-563. doi: 10.1177/1535370216684040. Epub 2016 Dec 30.
• [10] Can targeted metabolomics predict depression recovery? Results from the CO-MED trial.Transl Psychiatry. 2019 Jan 16;9(1):11. doi: 10.1038/s41398-018-0349-6.
• [11] A compound heterozygote of novel and recurrent DTDST mutations results in a novel intermediate phenotype of Desbuquois dysplasia, diastrophic dysplasia, and recessive form of multiple epiphyseal dysplasia.J Hum Genet. 2008;53(8):764-768. doi: 10.1007/s10038-008-0305-z. Epub 2008 Jun 14.
• [12] Phenotype-genotype correlation in Jewish patients suffering from familial Mediterranean fever (FMF).Eur J Hum Genet. 1998 Jan;6(1):95-7. doi: 10.1038/sj.ejhg.5200170.
• [13] Genetic diagnosis of familial hypercholesterolemia in affected relatives using pedigree tracing.Clin Biochem. 1996 Aug;29(4):371-7. doi: 10.1016/0009-9120(96)00017-3.
• [14] S-MED: sarcoma microRNA expression database.Lab Invest. 2010 May;90(5):753-61. doi: 10.1038/labinvest.2010.53. Epub 2010 Mar 8.
• [15] miR-219 inhibits the proliferation, migration and invasion of medulloblastoma cells by targeting CD164.Int J Mol Med. 2014 Jul;34(1):237-43. doi: 10.3892/ijmm.2014.1749. Epub 2014 Apr 22.
• [16] Pathological expression of tissue factor confers promising antitumor response to a novel therapeutic antibody SC1 in triple negative breast cancer and pancreatic adenocarcinoma.Oncotarget. 2017 Jul 10;8(35):59086-59102. doi: 10.18632/oncotarget.19175. eCollection 2017 Aug 29.
• [17] BARI 2D: A Reanalysis Focusing on Cardiovascular Events.Mayo Clin Proc. 2019 Nov;94(11):2249-2262. doi: 10.1016/j.mayocp.2019.04.015. Epub 2019 Oct 4.
• [18] Association of reduced type IX collagen gene expression in human osteoarthritic chondrocytes with epigenetic silencing by DNA hypermethylation.Arthritis Rheumatol. 2014 Nov;66(11):3040-51. doi: 10.1002/art.38774.
• [19] Relationship of COL9A1 and SOX9 Genes with Genetic Susceptibility of Postmenopausal Osteoporosis.Calcif Tissue Int. 2020 Mar;106(3):248-255. doi: 10.1007/s00223-019-00629-7. Epub 2019 Nov 15.
• [20] Exome-wide copy number variation analysis identifies a COL9A1 in frame deletion that is associated with hearing loss.Eur J Med Genet. 2019 Oct;62(10):103724. doi: 10.1016/j.ejmg.2019.103724. Epub 2019 Jul 14.
• [21] Modulation of Sympathetic Overactivity to Treat Resistant Hypertension.Curr Hypertens Rep. 2018 Sep 7;20(11):92. doi: 10.1007/s11906-018-0893-8.
• [22] Multiple Epiphyseal Dysplasia, Autosomal Dominant. 2003 Jan 8 [updated 2019 Apr 25]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [23] Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
• [24] Role of COL9A1 genetic polymorphisms in development of congenital talipes equinovarus in a Chinese population.Genet Mol Res. 2016 Nov 3;15(4). doi: 10.4238/gmr15048773.
• [25] Clinical efficacy of implementing Bio Immune(G)ene MEDicine in the treatment of chronic asthma with the objective of reducing or removing effectively corticosteroid therapy: A novel approach and promising results.Exp Ther Med. 2018 Jun;15(6):5133-5140. doi: 10.3892/etm.2018.6019. Epub 2018 Apr 2.
• [26] Multilayered patella: similar radiographic findings in pseudoachondroplasia and recessive multiple epiphyseal dysplasia.Am J Med Genet A. 2008 Jul 1;146A(13):1682-6. doi: 10.1002/ajmg.a.32313.
• [27] Therapeutic efficacy of vinorelbine against pediatric and adult central nervous system tumors.Cancer Chemother Pharmacol. 1998;42(6):479-82. doi: 10.1007/s002800050848.
• [28] Multiplex Enrichment and Detection of Rare KRAS Mutations in Liquid Biopsy Samples using Digital Droplet Pre-Amplification.Anal Chem. 2019 Jun 18;91(12):7516-7523. doi: 10.1021/acs.analchem.8b01605. Epub 2019 May 24.
• [29] Pseudoachondroplasia and multiple epiphyseal dysplasia: a 7-year comprehensive analysis of the known disease genes identify novel and recurrent mutations and provides an accurate assessment of their relative contribution.Hum Mutat. 2012 Jan;33(1):144-57. doi: 10.1002/humu.21611. Epub 2011 Oct 31.
• [30] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [31] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [32] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [33] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [34] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [35] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [36] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [37] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [38] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [39] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.