Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXSC9UB)

• DOT Name: Haptoglobin-related protein (HPR)
• Gene Name: HPR
• Related Disease:
  Bladder cancer
  Coronary heart disease
  Malaria
  Non-small-cell lung cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Acute lymphocytic leukaemia
  Advanced cancer
  B-cell neoplasm
  Benign neoplasm
  Breast cancer
  Breast neoplasm
  Cardiovascular disease
  Childhood acute lymphoblastic leukemia
  Endometrial cancer
  Endometrial carcinoma
  Epithelial ovarian cancer
  Glioma
  Melanoma
  Neuroblastoma
  Obesity
  Ovarian cancer
  Ovarian neoplasm
  Pheochromocytoma
  Primary cutaneous peripheral T-cell lymphoma not otherwise specified
  Prostate adenocarcinoma
  Small-cell lung cancer
  T-cell leukaemia
  T-cell lymphoma
  Zika virus infection
  Acute myelogenous leukaemia
  Breast carcinoma
  Lung cancer
  Lung carcinoma
  Pneumonia
  Precancerous condition
  Adult glioblastoma
  Glioblastoma multiforme
  Adult lymphoma
  African trypanosomiasis
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Lymphoma
  Pediatric lymphoma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: HPTR_HUMAN
• Pfam ID: PF00089
• Sequence:
  MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLR
  TEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAK
  MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVL
  HPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKY
  VMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSA
  FAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN
• Function: Primate-specific plasma protein associated with apolipoprotein L-I (apoL-I)-containing high-density lipoprotein (HDL). This HDL particle, termed trypanosome lytic factor-1 (TLF-1), mediates human innate immune protection against many species of African trypanosomes. Binds hemoglobin with high affinity and may contribute to the clearance of cell-free hemoglobin to allow hepatic recycling of heme iron.
• Tissue Specificity: In adult liver the amount of HPR mRNA is at the lower limit of detection, therefore the extent of its expression is at most less than 1000-fold that of the HP1F gene. No HPR mRNA can be detected in fetal liver. Expressed in Hep-G2 and leukemia MOLT-4 cell lines.
• KEGG Pathway: African trypanosomiasis (hsa05143)
• Reactome Pathway: Scavenging of heme from plasma (R-HSA-2168880)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder cancer	DISUHNM0	Definitive	Biomarker	[1]
Coronary heart disease	DIS5OIP1	Definitive	Genetic Variation	[2]
Malaria	DISQ9Y50	Definitive	Altered Expression	[3]
Non-small-cell lung cancer	DIS5Y6R9	Definitive	Biomarker	[4]
Urinary bladder cancer	DISDV4T7	Definitive	Biomarker	[1]
Urinary bladder neoplasm	DIS7HACE	Definitive	Biomarker	[1]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[7]
Benign neoplasm	DISDUXAD	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[10]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[11]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[5]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[12]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[13]
Glioma	DIS5RPEH	Strong	Biomarker	[14]
Melanoma	DIS1RRCY	Strong	Biomarker	[15]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[13]
Obesity	DIS47Y1K	Strong	Biomarker	[6]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[13]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[13]
Pheochromocytoma	DIS56IFV	Strong	Altered Expression	[8]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified	DIS5OHQF	Strong	Biomarker	[16]
Prostate adenocarcinoma	DISBZYU8	Strong	Biomarker	[17]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[18]
T-cell leukaemia	DISJ6YIF	Strong	Biomarker	[19]
T-cell lymphoma	DISSXRTQ	Strong	Biomarker	[13]
Zika virus infection	DISQUCTY	Strong	Biomarker	[20]
Acute myelogenous leukaemia	DISCSPTN	moderate	Altered Expression	[21]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[9]
Lung cancer	DISCM4YA	moderate	Biomarker	[22]
Lung carcinoma	DISTR26C	moderate	Biomarker	[22]
Pneumonia	DIS8EF3M	moderate	Altered Expression	[23]
Precancerous condition	DISV06FL	moderate	Biomarker	[24]
Adult glioblastoma	DISVP4LU	Disputed	Biomarker	[25]
Glioblastoma multiforme	DISK8246	Disputed	Biomarker	[25]
Adult lymphoma	DISK8IZR	Limited	Altered Expression	[26]
African trypanosomiasis	DISBIXK4	Limited	Genetic Variation	[27]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[28]
Liver cancer	DISDE4BI	Limited	Biomarker	[28]
Lymphoma	DISN6V4S	Limited	Altered Expression	[26]
Pediatric lymphoma	DIS51BK2	Limited	Altered Expression	[26]
Prostate cancer	DISF190Y	Limited	Biomarker	[29]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[29]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Haptoglobin-related protein (HPR).	[30]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Haptoglobin-related protein (HPR).	[31]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Haptoglobin-related protein (HPR).	[32]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Haptoglobin-related protein (HPR).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Haptoglobin-related protein (HPR).	[34]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Haptoglobin-related protein (HPR).	[35]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Haptoglobin-related protein (HPR).	[36]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Haptoglobin-related protein (HPR).	[37]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Haptoglobin-related protein (HPR).	[38]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Haptoglobin-related protein (HPR).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Haptoglobin-related protein (HPR).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Haptoglobin-related protein (HPR).	[40]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Haptoglobin-related protein (HPR).	[41]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A affects the expression of Haptoglobin-related protein (HPR).	[32]

References

• [1] N-(4-hydroxyphenyl)retinamide (4-HPR) modulates GADD45 expression in radiosensitive bladder cancer cell lines.Cancer Lett. 2002 Jun 28;180(2):131-7. doi: 10.1016/s0304-3835(01)00864-3.
• [2] Novel genetic loci associated with long-term deterioration in blood lipid concentrations and coronary artery disease in European adults.Int J Epidemiol. 2017 Aug 1;46(4):1211-1222. doi: 10.1093/ije/dyw245.
• [3] Individual variation in levels of haptoglobin-related protein in children from Gabon.PLoS One. 2012;7(11):e49816. doi: 10.1371/journal.pone.0049816. Epub 2012 Nov 20.
• [4] Combinational treatment with retinoic acid derivatives in non-small cell lung carcinoma in vitro.J Korean Med Sci. 2007 Sep;22 Suppl(Suppl):S52-60. doi: 10.3346/jkms.2007.22.S.S52.
• [5] Mechanism of synergy of N-(4-hydroxyphenyl)retinamide and ABT-737 in acute lymphoblastic leukemia cell lines: Mcl-1 inactivation.J Natl Cancer Inst. 2008 Apr 16;100(8):580-95. doi: 10.1093/jnci/djn076. Epub 2008 Apr 8.
• [6] Inhibitory effects of fenretinide metabolites N-[4-methoxyphenyl]retinamide (MPR) and 4-oxo-N-(4-hydroxyphenyl)retinamide (3-keto-HPR) on fenretinide molecular targets -carotene oxygenase 1, stearoyl-CoA desaturase 1 and dihydroceramide 4-desaturase 1.PLoS One. 2017 Apr 27;12(4):e0176487. doi: 10.1371/journal.pone.0176487. eCollection 2017.
• [7] Fenretinide via NOXA Induction, Enhanced Activity of the BCL-2 Inhibitor Venetoclax in High BCL-2-Expressing Neuroblastoma Preclinical Models.Mol Cancer Ther. 2019 Dec;18(12):2270-2282. doi: 10.1158/1535-7163.MCT-19-0385. Epub 2019 Sep 4.
• [8] Differential heparanase-1 expression in malignant and benign pheochromocytomas.J Surg Res. 2002 Nov;108(1):44-50. doi: 10.1006/jsre.2002.6451.
• [9] 4-HPR Is an Endoplasmic Reticulum Stress Aggravator and Sensitizes Breast Cancer Cells Resistant to TRAIL/Apo2L.Anticancer Res. 2018 Aug;38(8):4403-4416. doi: 10.21873/anticanres.12742.
• [10] N-(4-Hydroxyphenyl)retinamide is more potent than other phenylretinamides in inhibiting the growth of BRCA1-mutated breast cancer cells.Carcinogenesis. 2005 May;26(5):1000-7. doi: 10.1093/carcin/bgi038. Epub 2005 Feb 3.
• [11] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [12] A functional polymorphism in the promoter of the progesterone receptor gene associated with endometrial cancer risk.Proc Natl Acad Sci U S A. 2002 Sep 17;99(19):12263-8. doi: 10.1073/pnas.192172299. Epub 2002 Sep 6.
• [13] Cytotoxicity and molecular activity of fenretinide and metabolites in T-cell lymphoid malignancy, neuroblastoma, and ovarian cancer cell lines in physiological hypoxia.Anticancer Drugs. 2019 Feb;30(2):117-127. doi: 10.1097/CAD.0000000000000696.
• [14] Mechanism of 4-HPR-induced apoptosis in glioma cells: evidences suggesting role of mitochondrial-mediated pathway and endoplasmic reticulum stress. Carcinogenesis. 2006 Oct;27(10):2047-58. doi: 10.1093/carcin/bgl051. Epub 2006 May 4.
• [15] Inhibitory effects of N-(4-hydrophenyl) retinamide on liver cancer and malignant melanoma cells. World J Gastroenterol. 2005 Oct 7;11(37):5763-9. doi: 10.3748/wjg.v11.i37.5763.
• [16] Clinical development of fenretinide as an antineoplastic drug: Pharmacology perspectives.Exp Biol Med (Maywood). 2017 Jun;242(11):1178-1184. doi: 10.1177/1535370217706952. Epub 2017 Apr 21.
• [17] In vitro anti-invasive effects of N-(4-hydroxyphenyl)-retinamide on human prostatic adenocarcinoma.Anticancer Res. 1995 Jul-Aug;15(4):1429-34.
• [18] Growth inhibition and induction of apoptosis by fenretinide in small-cell lung cancer cell lines.J Natl Cancer Inst. 1995 Nov 15;87(22):1674-80. doi: 10.1093/jnci/87.22.1674.
• [19] Cell cycle inhibition in human BE-13 T cell leukemia cells by haptoglobin-related (HPR) antisense cDNA.Anticancer Res. 1998 May-Jun;18(3A):1745-50.
• [20] Identification of anti-flaviviral drugs with mosquitocidal and anti-Zika virus activity in Aedes aegypti.PLoS Negl Trop Dis. 2019 Aug 20;13(8):e0007681. doi: 10.1371/journal.pntd.0007681. eCollection 2019 Aug.
• [21] Nuclear retinoid receptors are involved in N-(4-hydroxyphenyl) retinamide (Fenretinide)-induced gene expression and growth inhibition in HL-60 acute myeloid leukemia cells. Leuk Lymphoma. 2004 May;45(5):979-85.
• [22] Anti-tumor activity of fenretinide complexed with human serum albumin in lung cancer xenograft mouse model.Oncotarget. 2014 Jul 15;5(13):4811-20. doi: 10.18632/oncotarget.2038.
• [23] Lectin Microarray Combined with Mass Spectrometry Identifies Haptoglobin-Related Protein (HPR) as a Potential Serologic Biomarker for Separating Nonbacterial Pneumonia from Bacterial Pneumonia in Childhood.Proteomics Clin Appl. 2018 Nov;12(6):e1800030. doi: 10.1002/prca.201800030. Epub 2018 Jun 10.
• [24] 4-HPR modulates gene expression in ovarian cells. Int J Cancer. 2006 Sep 1;119(5):1005-13. doi: 10.1002/ijc.21797.
• [25] Survivin knockdown and concurrent 4-HPR treatment controlled human glioblastoma in vitro and in vivo.Neuro Oncol. 2010 Nov;12(11):1088-101. doi: 10.1093/neuonc/noq079. Epub 2010 Aug 2.
• [26] Haptoglobin-related protein as a serum marker in malignant lymphoma.Pathol Oncol Res. 1998;4(4):271-6. doi: 10.1007/BF02905217.
• [27] A polymorphism in the haptoglobin, haptoglobin related protein locus is associated with risk of human sleeping sickness within Cameroonian populations.PLoS Negl Trop Dis. 2017 Oct 27;11(10):e0005979. doi: 10.1371/journal.pntd.0005979. eCollection 2017 Oct.
• [28] Fenretinide inhibits the proliferation and migration of human liver cancer HepG2 cells by downregulating the activation of myosin light chain kinase through the p38MAPK signaling pathway.Oncol Rep. 2018 Jul;40(1):518-526. doi: 10.3892/or.2018.6436. Epub 2018 May 16.
• [29] Mechanistic studies of the effects of the retinoid N-(4-hydroxyphenyl)retinamide on prostate cancer cell growth and apoptosis.Mol Carcinog. 1999 Mar;24(3):160-8. doi: 10.1002/(sici)1098-2744(199903)24:3<160::aid-mc2>3.0.co;2-m.
• [30] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [31] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [32] Comparison of base-line and chemical-induced transcriptomic responses in HepaRG and RPTEC/TERT1 cells using TempO-Seq. Arch Toxicol. 2018 Aug;92(8):2517-2531.
• [33] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [36] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [37] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [38] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [39] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [40] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [41] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.