Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY5JUX2)

• DOT Name: Attractin-like protein 1 (ATRNL1)
• Gene Name: ATRNL1
• Related Disease:
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Acute liver failure
  Ankylosing spondylitis
  Bone disease
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Cerebral palsy
  Cholestasis
  Choriocarcinoma
  Chromosomal disorder
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Fatty liver disease
  Germ cell tumor
  Hematologic disease
  Hepatocellular carcinoma
  Hypercalcaemia
  Hyperlipidemia
  Isolated cleft palate
  Kidney failure
  Liver cirrhosis
  Lung cancer
  Lung carcinoma
  Non-alcoholic fatty liver disease
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Pyropoikilocytosis, hereditary
  Renal cell carcinoma
  Sjogren syndrome
  Amyotrophic lateral sclerosis
  Hepatitis C virus infection
  Rheumatoid arthritis
  Acute myelogenous leukaemia
  Alzheimer disease
  Huntington disease
  Non-hodgkin lymphoma
  Bone osteosarcoma
  Congenital contractural arachnodactyly
  Familial hypocalciuric hypercalcemia 1
  Hypophosphatasia
  Myotonic dystrophy type 1
  Neoplasm
  Osteoporosis
  Osteosarcoma
• UniProt ID: ATRN1_HUMAN
• Pfam ID: PF00431 ; PF01344 ; PF13415 ; PF13854 ; PF01437
• Sequence:
  METGGRARTGTPQPAAPGVWRARPAGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQS
  KPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCT
  WLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEV
  VTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSVPSQVYCECDKYWK
  GEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFS
  PSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTPSRGPLQRYGHSL
  ALYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIME
  LDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKS
  IYVHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNT
  HNDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFS
  SVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNILRAKCPPKT
  AASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICNKLT
  SCKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRVNSSRENYDNAKLYCYNLS
  GNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGE
  PNDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCT
  SNGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGW
  CNDPSNTGRGHCIEGSSRGPMKLIGMHHSEMVLDTNLCPKEKNYEWSFIQCPACQCNGHS
  TCINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHLHTGKCFCTT
  KGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQS
  NKNLDISINASNNFNLNITWSVGSTAGTISGEETSIVSKNNIKEYRDSFSYEKFNFRSNP
  NITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWA
  SRRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVL
  TVFLCLPRGSSGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV
• Function: May play a role in melanocortin signaling pathways that regulate energy homeostasis.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Definitive	Biomarker	[1]
Liver cancer	DISDE4BI	Definitive	Biomarker	[1]
Acute liver failure	DIS5EZKX	Strong	Genetic Variation	[2]
Ankylosing spondylitis	DISRC6IR	Strong	Altered Expression	[3]
Bone disease	DISE1F82	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[6]
Cerebral palsy	DIS82ODL	Strong	Genetic Variation	[7]
Cholestasis	DISDJJWE	Strong	Biomarker	[8]
Choriocarcinoma	DISDBVNL	Strong	Biomarker	[9]
Chromosomal disorder	DISM5BB5	Strong	Altered Expression	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[11]
Colon cancer	DISVC52G	Strong	Altered Expression	[12]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[12]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[13]
Germ cell tumor	DIS62070	Strong	Altered Expression	[9]
Hematologic disease	DIS9XD9A	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[14]
Hypercalcaemia	DISKQ2K7	Strong	Biomarker	[15]
Hyperlipidemia	DIS61J3S	Strong	Altered Expression	[16]
Isolated cleft palate	DISV80CD	Strong	Genetic Variation	[7]
Kidney failure	DISOVQ9P	Strong	Biomarker	[17]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[18]
Lung cancer	DISCM4YA	Strong	Biomarker	[19]
Lung carcinoma	DISTR26C	Strong	Biomarker	[19]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Pyropoikilocytosis, hereditary	DISZGN3B	Strong	Biomarker	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[11]
Sjogren syndrome	DISUBX7H	Strong	Biomarker	[24]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Biomarker	[25]
Hepatitis C virus infection	DISQ0M8R	moderate	Genetic Variation	[26]
Rheumatoid arthritis	DISTSB4J	moderate	Altered Expression	[27]
Acute myelogenous leukaemia	DISCSPTN	Disputed	Genetic Variation	[28]
Alzheimer disease	DISF8S70	Disputed	Biomarker	[25]
Huntington disease	DISQPLA4	Disputed	Biomarker	[25]
Non-hodgkin lymphoma	DISS2Y8A	Disputed	Genetic Variation	[28]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[29]
Congenital contractural arachnodactyly	DISOM1K7	Limited	Biomarker	[30]
Familial hypocalciuric hypercalcemia 1	DISPW6O5	Limited	Genetic Variation	[31]
Hypophosphatasia	DISCQ0O2	Limited	Biomarker	[32]
Myotonic dystrophy type 1	DISJC0OX	Limited	Biomarker	[33]
Neoplasm	DISZKGEW	Limited	Altered Expression	[34]
Osteoporosis	DISF2JE0	Limited	Altered Expression	[35]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[29]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Attractin-like protein 1 (ATRNL1).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Attractin-like protein 1 (ATRNL1).	[40]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Attractin-like protein 1 (ATRNL1).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Attractin-like protein 1 (ATRNL1).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Attractin-like protein 1 (ATRNL1).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Attractin-like protein 1 (ATRNL1).	[41]

References

• [1] Point-of-Care Assay of Alkaline Phosphatase Enzymatic Activity Using a Thermometer or Temperature Discoloration Sticker as Readout.Anal Chem. 2019 Jun 18;91(12):7943-7949. doi: 10.1021/acs.analchem.9b01883. Epub 2019 May 31.
• [2] Outcomes of Acute Liver Injury in Adults Due to Wilson's Disease: Is Survival Without Transplant Possible?.Liver Transpl. 2020 Mar;26(3):330-336. doi: 10.1002/lt.25703.
• [3] Regulation of osteoblasts by alkaline phosphatase in ankylosing spondylitis.Int J Rheum Dis. 2019 Feb;22(2):252-261. doi: 10.1111/1756-185X.13419. Epub 2018 Nov 11.
• [4] Amifostine Suppresses the Side Effects of Radiation on BMSCs by Promoting Cell Proliferation and Reducing ROS Production.Stem Cells Int. 2019 Jan 9;2019:8749090. doi: 10.1155/2019/8749090. eCollection 2019.
• [5] Three gold indicators for breast cancer prognosis: a case-control study with ROC analysis for novel ratios related to CBC with (ALP and LDH).Mol Biol Rep. 2019 Apr;46(2):2013-2027. doi: 10.1007/s11033-019-04650-9. Epub 2019 Jan 31.
• [6] Pharmacodynamic effects of Dan-hong injection in rats with blood stasis syndrome.Biomed Pharmacother. 2019 Oct;118:109187. doi: 10.1016/j.biopha.2019.109187. Epub 2019 Jul 11.
• [7] Oral administration of Nigella sativa oil and thymoquinone attenuates long term cisplatin treatment induced toxicity and oxidative damage in rat kidney.Biomed Pharmacother. 2017 Dec;96:912-923. doi: 10.1016/j.biopha.2017.12.007. Epub 2017 Dec 7.
• [8] Paeoniflorin attenuates ANIT-induced cholestasis by inhibiting apoptosis in vivo via mitochondria-dependent pathway.Biomed Pharmacother. 2017 May;89:696-704. doi: 10.1016/j.biopha.2017.02.084. Epub 2017 Mar 6.
• [9] Expression of the germ cell alkaline phosphatase gene in human choriocarcinoma cells.J Biol Chem. 1989 Jul 25;264(21):12611-9.
• [10] Granulocytes' enzymes as biomarkers of radiotoxicity in individuals occupationally exposed to low-level radiation.J BUON. 2009 Jan-Mar;14(1):85-91.
• [11] Reduced L/B/K alkaline phosphatase gene expression in renal cell carcinoma: plausible role in tumorigenesis.Biochimie. 2014 Sep;104:27-35. doi: 10.1016/j.biochi.2014.05.011. Epub 2014 Jun 5.
• [12] The intestinal epithelial cell differentiation marker intestinal alkaline phosphatase (ALPi) is selectively induced by histone deacetylase inhibitors (HDACi) in colon cancer cells in a Kruppel-like factor 5 (KLF5)-dependent manner.J Biol Chem. 2014 Sep 5;289(36):25306-16. doi: 10.1074/jbc.M114.557546. Epub 2014 Jul 18.
• [13] Evaluation of the therapeutic potential effect of Fas receptor gene knockdown in experimental model of non-alcoholic steatohepatitis.Free Radic Res. 2019 May;53(5):486-496. doi: 10.1080/10715762.2019.1608982. Epub 2019 May 7.
• [14] Hypersplenism is correlated with increased risk of hepatocellular carcinoma in patients with post-hepatitis cirrhosis.Tumour Biol. 2016 Jul;37(7):8889-900. doi: 10.1007/s13277-015-4764-5. Epub 2016 Jan 11.
• [15] The chloride/phosphate ratio combined with alkaline phosphatase as a valuable predictive marker for primary hyperparathyroidism in Chinese individuals.Sci Rep. 2017 Jul 7;7(1):4868. doi: 10.1038/s41598-017-05183-6.
• [16] Anti-hyperlipidemic and antioxidant effects of alkali-extractable mycelia polysaccharides by Pleurotus eryngii var. tuolensis.Carbohydr Polym. 2017 Nov 1;175:282-292. doi: 10.1016/j.carbpol.2017.08.009. Epub 2017 Aug 3.
• [17] Rat liver and kidney post-mitochondrial dysfunction by addition of chronic mixed metal intoxication and hepatorenal wellness mediated by phenolic components from Croton zambiscus leaves.Environ Toxicol Pharmacol. 2020 Feb;74:103293. doi: 10.1016/j.etap.2019.103293. Epub 2019 Nov 9.
• [18] Risk of endoscopic biliary interventions in primary sclerosing cholangitis is similar between patients with and without cirrhosis.PLoS One. 2018 Aug 20;13(8):e0202686. doi: 10.1371/journal.pone.0202686. eCollection 2018.
• [19] Bone turnover markers and novel biomarkers in lung cancer bone metastases.Biomarkers. 2018 Sep;23(6):518-526. doi: 10.1080/1354750X.2018.1463566. Epub 2018 Apr 23.
• [20] Chicory (Cichorium intybus L.) polysaccharides attenuate high-fat diet induced non-alcoholic fatty liver disease via AMPK activation.Int J Biol Macromol. 2018 Oct 15;118(Pt A):886-895. doi: 10.1016/j.ijbiomac.2018.06.140. Epub 2018 Jun 28.
• [21] Identification of atypical ATRNL1 insertion to EML4-ALK fusion gene in NSCLC.Lung Cancer. 2015 Mar;87(3):318-20. doi: 10.1016/j.lungcan.2015.01.002. Epub 2015 Jan 10.
• [22] Bufalin suppresses the migration and invasion of prostate cancer cells through HOTAIR, the sponge of miR-520b.Acta Pharmacol Sin. 2019 Sep;40(9):1228-1236. doi: 10.1038/s41401-019-0234-8. Epub 2019 Apr 26.
• [23] Tissue non-specific alkaline phosphatase activity and mineralization capacity of bi-allelic mutations from severe perinatal and asymptomatic hypophosphatasia phenotypes: Results from an in vitro mutagenesis model.Bone. 2019 Oct;127:9-16. doi: 10.1016/j.bone.2019.05.031. Epub 2019 May 27.
• [24] Th17/Treg cell level and clinical characteristics of peripheral blood of patients with Sjogren's syndrome complicated with primary biliary cirrhosis.Medicine (Baltimore). 2019 Jun;98(24):e15952. doi: 10.1097/MD.0000000000015952.
• [25] The cargo receptor SQSTM1 ameliorates neurofibrillary tangle pathology and spreading through selective targeting of pathological MAPT (microtubule associated protein tau).Autophagy. 2019 Apr;15(4):583-598. doi: 10.1080/15548627.2018.1532258. Epub 2018 Oct 16.
• [26] Effect of IL15 rs10833 and SCARB1 rs10846744 on virologic responses in chronic hepatitis C patients treated with pegylated interferon- and ribavirin.Gene. 2017 Sep 30;630:28-34. doi: 10.1016/j.gene.2017.08.005. Epub 2017 Aug 4.
• [27] Rosmarinic acid exerts an antagonistic effect on vascular calcification by regulating the Nrf2 signalling pathway.Free Radic Res. 2019 Feb;53(2):187-197. doi: 10.1080/10715762.2018.1558447. Epub 2019 Mar 13.
• [28] A case of angioimmunoblastic T-cell non-Hodgkin lymphoma with a neocentric inv dup(1).Cancer Genet Cytogenet. 2010 Oct 1;202(1):38-42. doi: 10.1016/j.cancergencyto.2010.06.004.
• [29] Lung cells support osteosarcoma cell migration and survival.BMC Cancer. 2017 Jan 25;17(1):78. doi: 10.1186/s12885-017-3047-5.
• [30] Surveillance of primary sclerosing cholangitis with ERC and brush cytology: risk factors for cholangiocarcinoma.Scand J Gastroenterol. 2017 Feb;52(2):242-249. doi: 10.1080/00365521.2016.1250281. Epub 2016 Nov 3.
• [31] Association between iron overload and osteoporosis in patients with hereditary hemochromatosis.Osteoporos Int. 2009 Apr;20(4):549-55. doi: 10.1007/s00198-008-0701-4. Epub 2008 Jul 26.
• [32] HYPOPHOSPHATASIA: CLINICAL ASSESSMENT AND MANAGEMENT IN THE ADULT PATIENT-A NARRATIVE REVIEW.Endocr Pract. 2018 Dec;24(12):1086-1092. doi: 10.4158/EP-2018-0194. Epub 2018 Oct 5.
• [33] Alternative splicing of PDLIM3/ALP, for -actinin-associated LIM protein 3, is aberrant in persons with myotonic dystrophy.Biochem Biophys Res Commun. 2011 May 27;409(1):64-9. doi: 10.1016/j.bbrc.2011.04.106. Epub 2011 Apr 28.
• [34] The effects of PTBP3 silencing on the proliferation and differentiation of MKN45 human gastric cancer cells.Life Sci. 2014 Sep 26;114(1):29-35. doi: 10.1016/j.lfs.2014.07.038. Epub 2014 Aug 10.
• [35] LncRNA NEAT1/miR-29b-3p/BMP1 axis promotes osteogenic differentiation in human bone marrow-derived mesenchymal stem cells.Pathol Res Pract. 2019 Mar;215(3):525-531. doi: 10.1016/j.prp.2018.12.034. Epub 2018 Dec 31.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.