Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYHL4I7)

• DOT Name: Influenza virus NS1A-binding protein (IVNS1ABP)
• Synonyms: NS1-BP; NS1-binding protein; Aryl hydrocarbon receptor-associated protein 3; Kelch-like protein 39
• Gene Name: IVNS1ABP
• Related Disease:
  Hepatitis
  Hepatitis A virus infection
  Respiratory syncytial virus infection
  Advanced cancer
  Anemia
  Astrocytoma
  Colorectal carcinoma
  Dengue
  Early-onset parkinsonism-intellectual disability syndrome
  Esophageal squamous cell carcinoma
  Hepatitis C virus infection
  Isolated congenital microcephaly
  Neoplasm
  Non-insulin dependent diabetes
  Prostate cancer
  Prostate neoplasm
  Viral encephalitis
  Zika virus infection
  Type-1/2 diabetes
  46,XY sex reversal 2
  Arthritis
  Charcot-Marie-Tooth disease type 3
  Immunodeficiency 70
  Rheumatoid arthritis
• UniProt ID: NS1BP_HUMAN
• PDB ID: 5YY8; 6N34; 6N3H
• Pfam ID: PF07707 ; PF00651 ; PF01344
• Sequence:
  MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
  FNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQV
  CGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEV
  MLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQ
  AEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNATVQSPKHEWKIVASEKTSNN
  TYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKPMSPMQYARSG
  LGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV
  GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLK
  NCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWT
  LIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAG
  IATVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF
• Function: Involved in many cell functions, including pre-mRNA splicing, the aryl hydrocarbon receptor (AHR) pathway, F-actin organization and protein ubiquitination. Plays a role in the dynamic organization of the actin skeleton as a stabilizer of actin filaments by association with F-actin through Kelch repeats. Protects cells from cell death induced by actin destabilization. Functions as modifier of the AHR/Aryl hydrocarbon receptor pathway increasing the concentration of AHR available to activate transcription. In addition, functions as a negative regulator of BCR(KLHL20) E3 ubiquitin ligase complex to prevent ubiquitin-mediated proteolysis of PML and DAPK1, two tumor suppressors. Inhibits pre-mRNA splicing (in vitro) ; (Microbial infection) Involved in the alternative splicing of influenza A virus M1 mRNA through interaction with HNRNPK, thereby facilitating the generation of viral M2 protein.

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatitis	DISXXX35	Definitive	Biomarker	[1]
Hepatitis A virus infection	DISUMFQV	Definitive	Biomarker	[1]
Respiratory syncytial virus infection	DIS7FWHY	Definitive	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Anemia	DISTVL0C	Strong	Biomarker	[4]
Astrocytoma	DISL3V18	Strong	Biomarker	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[6]
Dengue	DISKH221	Strong	Biomarker	[7]
Early-onset parkinsonism-intellectual disability syndrome	DIS206QS	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[9]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[10]
Isolated congenital microcephaly	DISUXHZ6	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[12]
Prostate cancer	DISF190Y	Strong	Biomarker	[13]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[13]
Viral encephalitis	DIS9G09S	Strong	Biomarker	[14]
Zika virus infection	DISQUCTY	Strong	Biomarker	[11]
Type-1/2 diabetes	DISIUHAP	moderate	Genetic Variation	[12]
46,XY sex reversal 2	DIS0USUN	Limited	Genetic Variation	[15]
Arthritis	DIST1YEL	Limited	Biomarker	[16]
Charcot-Marie-Tooth disease type 3	DIS6DQK1	Limited	Genetic Variation	[15]
Immunodeficiency 70	DIS9MITO	Limited	Autosomal dominant	[17]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[16]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[18]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[20]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[22]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[24]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[25]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[26]
Marinol	DM70IK5	Approved	Marinol increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[27]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[28]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[29]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[30]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[33]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[35]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[36]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[37]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Influenza virus NS1A-binding protein (IVNS1ABP).	[38]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Influenza virus NS1A-binding protein (IVNS1ABP).	[23]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Influenza virus NS1A-binding protein (IVNS1ABP).	[32]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Influenza virus NS1A-binding protein (IVNS1ABP).	[34]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Influenza virus NS1A-binding protein (IVNS1ABP).	[34]

References

• [1] Detection of antibody to hepatitis C E2/NS1 protein in patients with type C hepatitis.Biochem Biophys Res Commun. 1992 Nov 30;189(1):565-71. doi: 10.1016/0006-291x(92)91595-h.
• [2] Inhibition of respiratory syncytial virus infection with intranasal siRNA nanoparticles targeting the viral NS1 gene.Nat Med. 2005 Jan;11(1):56-62. doi: 10.1038/nm1174. Epub 2004 Dec 26.
• [3] Effect of the parvovirus H-1 non-structural protein NS1 on the tumorigenicity of human gastric cancer cells.J Dig Dis. 2012 Jul;13(7):366-73. doi: 10.1111/j.1751-2980.2012.00601.x.
• [4] Canine Parvovirus ns1 gene and Chicken Anemia vp3 gene induce partial oncolysis of Canine Transmissible Venereal Tumor.Sci Rep. 2017 Nov 13;7(1):15419. doi: 10.1038/s41598-017-15734-6.
• [5] Remodeling of the Actin Network Associated with the Non-Structural Protein 1 (NS1) of West Nile Virus and Formation of NS1-Containing Tunneling Nanotubes.Viruses. 2019 Sep 27;11(10):901. doi: 10.3390/v11100901.
• [6] Identification of LEA, a podocalyxin-like glycoprotein, as a predictor for the progression of colorectal cancer.Cancer Med. 2018 Oct;7(10):5155-5166. doi: 10.1002/cam4.1765. Epub 2018 Sep 12.
• [7] Combination of Nonstructural Protein 1-Based Enzyme-Linked Immunosorbent Assays Can Detect and Distinguish Various Dengue Virus and Zika Virus Infections.J Clin Microbiol. 2019 Jan 30;57(2):e01464-18. doi: 10.1128/JCM.01464-18. Print 2019 Feb.
• [8] The C terminus of NS1 protein of influenza A/WSN/1933(H1N1) virus modulates antiviral responses in infected human macrophages and mice.J Gen Virol. 2015 Aug;96(8):2086-2091. doi: 10.1099/vir.0.000171. Epub 2015 May 1.
• [9] NS1-binding protein radiosensitizes esophageal squamous cell carcinoma by transcriptionally suppressing c-Myc.Cancer Commun (Lond). 2018 Jun 5;38(1):33. doi: 10.1186/s40880-018-0307-y.
• [10] Antibody response to E2 glycoprotein induced in mice by immunization with plasmid DNA containing sequence derived from a Chinese genotype III/2a isolate of hepatitis C virus.Chin Med J (Engl). 1999 Feb;112(2):166-8.
• [11] Antibodies Elicited by an NS1-Based Vaccine Protect Mice against Zika Virus.mBio. 2019 Apr 2;10(2):e02861-18. doi: 10.1128/mBio.02861-18.
• [12] Prevalence and clinical characteristics of mitochondrial tRNA leu(UUR) mt 3243 A-->G and ND-1 gene mt 3316 G-->A mutations in Chinese patients with type 2 diabetes.Chin Med J (Engl). 2001 Nov;114(11):1205-7.
• [13] Microarray comparison of prostate tumor gene expression in African-American and Caucasian American males: a pilot project study.Infect Agent Cancer. 2009 Feb 10;4 Suppl 1(Suppl 1):S3. doi: 10.1186/1750-9378-4-S1-S3.
• [14] Structural Study of the C-Terminal Domain of Nonstructural Protein 1 from Japanese Encephalitis Virus.J Virol. 2018 Mar 14;92(7):e01868-17. doi: 10.1128/JVI.01868-17. Print 2018 Apr 1.
• [15] Impact of dengue virus infection and its control.FEMS Immunol Med Microbiol. 1997 Aug;18(4):291-300. doi: 10.1111/j.1574-695X.1997.tb01058.x.
• [16] Human parvovirus B19 transgenic mice become susceptible to polyarthritis.J Immunol. 2004 Oct 1;173(7):4675-83. doi: 10.4049/jimmunol.173.7.4675.
• [17] Whole-genome sequencing of a sporadic primary immunodeficiency cohort. Nature. 2020 Jul;583(7814):90-95. doi: 10.1038/s41586-020-2265-1. Epub 2020 May 6.
• [18] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [21] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [26] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [27] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [28] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [29] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [30] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [31] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [32] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [33] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [34] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [35] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [36] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [37] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [38] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.