Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ1VRBH)

• DOT Name: Embryonic growth/differentiation factor 1 (GDF1)
• Synonyms: GDF-1
• Gene Name: GDF1
• Related Disease:
  Congenital heart defects, multiple types, 6
  Differentiated thyroid carcinoma
  Malaria
  Non-insulin dependent diabetes
  Parkinson disease
  Adenoma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Carcinoma
  Colorectal adenoma
  Crohn disease
  Dementia
  Dengue
  Fatty liver disease
  Gastric cancer
  Graves disease
  Hairy cell leukaemia
  Head-neck squamous cell carcinoma
  Inflammatory bowel disease
  Lung cancer
  Lung carcinoma
  Medullary thyroid gland carcinoma
  Myocardial infarction
  Neoplasm
  Plasma cell myeloma
  Right atrial isomerism
  Sleep disorder
  Small lymphocytic lymphoma
  Stomach cancer
  Testicular cancer
  Thyroid gland papillary carcinoma
  Visceral heterotaxy
  Metastatic malignant neoplasm
  Myocardial ischemia
  Transposition of the great arteries
  Cerebral infarction
  Nervous system disease
  Neuroblastoma
  Congenital heart disease
  Conotruncal heart malformations
  Helicoid peripapillary chorioretinal degeneration
  Tetralogy of fallot
  Thyroid gland undifferentiated (anaplastic) carcinoma
• UniProt ID: GDF1_HUMAN
• Pfam ID: PF00019
• Sequence:
  MPPPQQGPCGHHLLLLLALLLPSLPLTRAPVPPGPAAALLQALGLRDEPQGAPRLRPVPP
  VMWRLFRRRDPQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASA
  AGHCPEWTVVFDLSAVEPAERPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGP
  VLLRQLVPALGPPVRAELLGAAWARNASWPRSLRLALALRPRAPAACARLAEASLLLVTL
  DPRLCHPLARPRRDAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQC
  ALPVALSGSGGPPALNHAVLRALMHAAAPGAADLPCCVPARLSPISVLFFDNSDNVVLRQ
  YEDMVVDECGCR
• Function: May mediate cell differentiation events during embryonic development.
• Tissue Specificity: Expressed in the brain.
• KEGG Pathway: Cytokine-cytokine receptor interaction (hsa04060)
• Reactome Pathway: Signaling by NODAL (R-HSA-1181150)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Congenital heart defects, multiple types, 6	DISQR1H0	Definitive	Autosomal recessive	[1]
Differentiated thyroid carcinoma	DIS1V20Y	Definitive	Biomarker	[2]
Malaria	DISQ9Y50	Definitive	Biomarker	[3]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[4]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[5]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[8]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[8]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[6]
Colorectal adenoma	DISTSVHM	Strong	Biomarker	[6]
Crohn disease	DIS2C5Q8	Strong	Altered Expression	[9]
Dementia	DISXL1WY	Strong	Genetic Variation	[10]
Dengue	DISKH221	Strong	Biomarker	[11]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[12]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Graves disease	DISU4KOQ	Strong	Biomarker	[14]
Hairy cell leukaemia	DISTD2E5	Strong	Biomarker	[15]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[16]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[9]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[8]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[8]
Medullary thyroid gland carcinoma	DISHBL3K	Strong	Genetic Variation	[17]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[18]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[19]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[20]
Right atrial isomerism	DIS2SZ2Q	Strong	Autosomal recessive	[21]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[22]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[23]
Stomach cancer	DISKIJSX	Strong	Biomarker	[13]
Testicular cancer	DIS6HNYO	Strong	Genetic Variation	[24]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[25]
Visceral heterotaxy	DIS1DV90	Strong	Genetic Variation	[26]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[2]
Myocardial ischemia	DISFTVXF	moderate	Genetic Variation	[27]
Transposition of the great arteries	DISPXJ8X	moderate	Genetic Variation	[28]
Cerebral infarction	DISR1WNP	Disputed	Biomarker	[29]
Nervous system disease	DISJ7GGT	Disputed	Biomarker	[30]
Neuroblastoma	DISVZBI4	Disputed	Biomarker	[29]
Congenital heart disease	DISQBA23	Limited	Genetic Variation	[31]
Conotruncal heart malformations	DIS7FMIG	Limited	Autosomal dominant	[32]
Helicoid peripapillary chorioretinal degeneration	DISFSS5N	Limited	Biomarker	[19]
Tetralogy of fallot	DISMHFNW	Limited	Autosomal dominant	[32]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Limited	Genetic Variation	[33]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Embryonic growth/differentiation factor 1 (GDF1).	[34]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[36]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[37]
Marinol	DM70IK5	Approved	Marinol increases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[38]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[39]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[40]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[42]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Embryonic growth/differentiation factor 1 (GDF1).	[43]

References

• [1] Recessively inherited right atrial isomerism caused by mutations in growth/differentiation factor 1 (GDF1). Hum Mol Genet. 2010 Jul 15;19(14):2747-53. doi: 10.1093/hmg/ddq164. Epub 2010 Apr 22.
• [2] LONG-TERM OUTCOMES AND PROGNOSTIC FACTORS IN PATIENTS WITH DIFFERENTIATED THYROID CARCINOMA AND BONE METASTASES.Endocr Pract. 2019 May;25(5):427-437. doi: 10.4158/EP-2018-0465. Epub 2019 Jan 18.
• [3] A Time Series Analysis: Weather Factors, Human Migration and Malaria Cases in Endemic Area of Purworejo, Indonesia, 2005-2014.Iran J Public Health. 2018 Apr;47(4):499-509.
• [4] Predictors and Clinical Outcomes of Treatment Intensification in Patients With Type 2 Diabetes Uncontrolled on Basal Insulin in a Real-World Setting.Endocr Pract. 2018 Sep;24(9):805-814. doi: 10.4158/EP-2017-0261. Epub 2018 Jul 5.
• [5] Comparison Between Automatic and Visual Scorings of REM Sleep Without Atonia for the Diagnosis of REM Sleep Behavior Disorder in Parkinson Disease.Sleep. 2017 Feb 1;40(2). doi: 10.1093/sleep/zsw060.
• [6] Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study.BMC Cancer. 2006 Jul 3;6:175. doi: 10.1186/1471-2407-6-175.
• [7] (18)F-FDG-PET SUV AS A PROGNOSTIC MARKER OF INCREASING SIZE IN THYROID CANCER TUMORS.Endocr Pract. 2017 Feb;23(2):182-189. doi: 10.4158/EP161390.OR. Epub 2016 Nov 16.
• [8] A haplotype of polymorphisms in ASE-1, RAI and ERCC1 and the effects of tobacco smoking and alcohol consumption on risk of colorectal cancer: a Danish prospective case-cohort study.BMC Cancer. 2008 Feb 20;8:54. doi: 10.1186/1471-2407-8-54.
• [9] mTNF reverse signalling induced by TNF antagonists involves a GDF-1 dependent pathway: implications for Crohn's disease.Gut. 2013 Mar;62(3):376-86. doi: 10.1136/gutjnl-2011-300384. Epub 2012 Apr 25.
• [10] Impairment of ceramide synthesis causes a novel progressive myoclonus epilepsy. Ann Neurol. 2014 Aug;76(2):206-12. doi: 10.1002/ana.24170. Epub 2014 May 20.
• [11] Influence of meteorological variables on dengue incidence in the municipality of Arapiraca, Alagoas, Brazil.Rev Soc Bras Med Trop. 2017 May-Jun;50(3):309-314. doi: 10.1590/0037-8682-0432-2016.
• [12] Hepatocyte-specific deletion of LASS2 protects against diet-induced hepatic steatosis and insulin resistance.Free Radic Biol Med. 2018 May 20;120:330-341. doi: 10.1016/j.freeradbiomed.2018.04.003. Epub 2018 Apr 4.
• [13] Epigenetic silencing of GDF1 disrupts SMAD signaling to reinforce gastric cancer development.Oncogene. 2016 Apr 21;35(16):2133-44. doi: 10.1038/onc.2015.276. Epub 2015 Jul 27.
• [14] Alemtuzumab-induced thyroid events in multiple sclerosis: a systematic review and meta-analysis.J Endocrinol Invest. 2020 Feb;43(2):219-229. doi: 10.1007/s40618-019-01105-7. Epub 2019 Aug 26.
• [15] Expression of CD45 isoforms in chronic B-cell leukaemias.Leuk Res. 1993 Mar;17(3):209-16. doi: 10.1016/0145-2126(93)90003-4.
• [16] Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas.Mol Cancer Ther. 2007 Feb;6(2):712-22. doi: 10.1158/1535-7163.MCT-06-0558.
• [17] Primary Adrenal Insufficiency During Lenvatinib or Vandetanib and Improvement of Fatigue After Cortisone Acetate Therapy.J Clin Endocrinol Metab. 2019 Mar 1;104(3):779-784. doi: 10.1210/jc.2018-01836.
• [18] Cardioprotective role of growth/differentiation factor 1 in post-infarction left ventricular remodelling and dysfunction.J Pathol. 2015 Jul;236(3):360-72. doi: 10.1002/path.4523. Epub 2015 Mar 30.
• [19] Risk Haplotypes Uniquely Associated with Radioiodine-Refractory Thyroid Cancer Patients of High African Ancestry.Thyroid. 2019 Apr;29(4):530-539. doi: 10.1089/thy.2018.0687. Epub 2019 Feb 13.
• [20] The importance of a sub-region on chromosome 19q13.3 for prognosis of multiple myeloma patients after high-dose treatment and stem cell support: a linkage disequilibrium mapping in RAI and CD3EAP.Ann Hematol. 2011 Jun;90(6):675-84. doi: 10.1007/s00277-010-1105-z. Epub 2010 Nov 3.
• [21] Regulation of left-right patterning in mice by growth/differentiation factor-1. Nat Genet. 2000 Mar;24(3):262-5. doi: 10.1038/73472.
• [22] Search trends preceding increases in suicide: A cross-correlation study of monthly Google search volume and suicide rate using transfer function models.J Affect Disord. 2020 Feb 1;262:155-164. doi: 10.1016/j.jad.2019.11.014. Epub 2019 Nov 4.
• [23] CD11c expression in chronic lymphocytic leukemia revisited, related with complications and survival.Int J Lab Hematol. 2017 Oct;39(5):552-556. doi: 10.1111/ijlh.12695. Epub 2017 Jun 12.
• [24] Polymorphisms in RAI and in genes of nucleotide and base excision repair are not associated with risk of testicular cancer.Cancer Lett. 2005 Jul 28;225(2):245-51. doi: 10.1016/j.canlet.2005.03.021.
• [25] BRAF V600E and Retinoic Acid in Radioiodine-Refractory Papillary Thyroid Cancer.Horm Metab Res. 2019 Jan;51(1):69-75. doi: 10.1055/a-0765-9078. Epub 2018 Nov 5.
• [26] Contribution of rare inherited and de novo variants in 2,871 congenital heart disease probands. Nat Genet. 2017 Nov;49(11):1593-1601. doi: 10.1038/ng.3970. Epub 2017 Oct 9.
• [27] Exposure to air pollution and risk of hospitalization for cardiovascular diseases amongst Vietnamese adults: Case-crossover study.Sci Total Environ. 2020 Feb 10;703:134637. doi: 10.1016/j.scitotenv.2019.134637. Epub 2019 Nov 3.
• [28] Loss-of-function mutations in growth differentiation factor-1 (GDF1) are associated with congenital heart defects in humans. Am J Hum Genet. 2007 Nov;81(5):987-94. doi: 10.1086/522890. Epub 2007 Sep 28.
• [29] The Shc protein RAI promotes an adaptive cell survival program in hypoxic neuroblastoma cells.J Cell Physiol. 2018 May;233(5):4282-4293. doi: 10.1002/jcp.26247. Epub 2017 Nov 24.
• [30] Whole Genome Expression Analysis in a Mouse Model of Tauopathy Identifies MECP2 as a Possible Regulator of Tau Pathology.Front Mol Neurosci. 2017 Mar 17;10:69. doi: 10.3389/fnmol.2017.00069. eCollection 2017.
• [31] Association of functional variant in GDF1 promoter with risk of congenital heart disease and its regulation by Nkx2.5.Clin Sci (Lond). 2019 Jun 17;133(12):1281-1295. doi: 10.1042/CS20181024. Print 2019 Jun 28.
• [32] Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
• [33] Targeted Therapy in Thyroid Cancer: State of the Art.Clin Oncol (R Coll Radiol). 2017 May;29(5):316-324. doi: 10.1016/j.clon.2017.02.009. Epub 2017 Mar 17.
• [34] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [37] Arsenic suppresses GDF1 expression via ROS-dependent downregulation of specificity protein 1. Environ Pollut. 2021 Feb 15;271:116302. doi: 10.1016/j.envpol.2020.116302. Epub 2020 Dec 15.
• [38] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [39] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [40] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [41] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.