Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1C8HQ4)

• DOT Name: General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2)
• Synonyms: TFIIH subunit XPD; EC 3.6.4.12; Basic transcription factor 2 80 kDa subunit; BTF2 p80; CXPD; DNA excision repair protein ERCC-2; DNA repair protein complementing XP-D cells; TFIIH basal transcription factor complex 80 kDa subunit; TFIIH 80 kDa subunit; TFIIH p80; Xeroderma pigmentosum group D-complementing protein
• Gene Name: ERCC2
• Related Disease:
  Cerebrooculofacioskeletal syndrome 2
  Lung neoplasm
  Trichothiodystrophy 1, photosensitive
  Xeroderma pigmentosum group D
  Acute lymphocytic leukaemia
  Adenocarcinoma
  Age-related macular degeneration
  B-cell lymphoma
  Basal cell carcinoma
  Bladder cancer
  Breast neoplasm
  Carcinoma of esophagus
  Cervical carcinoma
  Chromosomal disorder
  Coronary heart disease
  Epidermolytic ichthyosis
  Esophageal adenocarcinoma
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Hepatocellular carcinoma
  Hereditary diffuse gastric adenocarcinoma
  Lung adenocarcinoma
  Lymphoma, non-Hodgkin, familial
  Neoplasm
  Neoplasm of esophagus
  Non-hodgkin lymphoma
  Sensorineural hearing loss disorder
  Skin disease
  Skin neoplasm
  Small lymphocytic lymphoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Xeroderma pigmentosum group A
  Colorectal neoplasm
  Gastric neoplasm
  Melanocytic nevus
  Sarcoma
  Squamous cell carcinoma
  COFS syndrome
  Trichothiodystrophy
  Xeroderma pigmentosum
  Xeroderma pigmentosum-Cockayne syndrome complex
  Bone osteosarcoma
  Cataract
  Cockayne syndrome
  Colon carcinoma
  Endometrial cancer
  Endometrial carcinoma
  Intellectual disability
  Leukemia
  Osteosarcoma
  Prostate neoplasm
• UniProt ID: ERCC2_HUMAN
• PDB ID: 5IVW ; 5IY6 ; 5IY7 ; 5IY8 ; 5IY9 ; 5OF4 ; 6NMI ; 6O9L ; 6O9M ; 6RO4 ; 6TUN ; 7AD8 ; 7EGB ; 7EGC ; 7ENA ; 7ENC ; 7LBM ; 7NVR ; 7NVW ; 7NVX ; 7NVY ; 7NVZ ; 7NW0 ; 8BVW ; 8BYQ ; 8EBS ; 8EBT ; 8EBU ; 8EBV ; 8EBW ; 8EBX ; 8EBY ; 8GXQ ; 8GXS ; 8WAK ; 8WAL ; 8WAN ; 8WAO ; 8WAP ; 8WAQ ; 8WAR ; 8WAS
• EC Number: 3.6.4.12
• Pfam ID: PF06733 ; PF06777 ; PF13307
• Sequence:
  MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQ
  RAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPE
  VTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDL
  KALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
  NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE
  TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSG
  LAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP
  FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
  FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFT
  SYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA
  RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHA
  AQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
  LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
• Function: ATP-dependent 5'-3' DNA helicase, component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. The ATP-dependent helicase activity of XPD/ERCC2 is required for DNA opening. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. XPD/ERCC2 acts by forming a bridge between CAK and the core-TFIIH complex. Involved in the regulation of vitamin-D receptor activity. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation. Might have a role in aging process and could play a causative role in the generation of skin cancers.
• KEGG Pathway:
  Basal transcription factors (hsa03022)
  Nucleotide excision repair (hsa03420)
• Reactome Pathway:
  Formation of the Early Elongation Complex (R-HSA-113418)
  Formation of HIV elongation complex in the absence of HIV Tat (R-HSA-167152)
  Formation of the HIV-1 Early Elongation Complex (R-HSA-167158)
  RNA Pol II CTD phosphorylation and interaction with CE during HIV infection (R-HSA-167160)
  HIV Transcription Initiation (R-HSA-167161)
  RNA Polymerase II HIV Promoter Escape (R-HSA-167162)
  Transcription of the HIV genome (R-HSA-167172)
  Formation of HIV-1 elongation complex containing HIV-1 Tat (R-HSA-167200)
  Tat-mediated elongation of the HIV-1 transcript (R-HSA-167246)
  Cytosolic iron-sulfur cluster assembly (R-HSA-2564830)
  NoRC negatively regulates rRNA expression (R-HSA-427413)
  Formation of Incision Complex in GG-NER (R-HSA-5696395)
  Dual Incision in GG-NER (R-HSA-5696400)
  RNA Polymerase II Pre-transcription Events (R-HSA-674695)
  Formation of TC-NER Pre-Incision Complex (R-HSA-6781823)
  Transcription-Coupled Nucleotide Excision Repair (TC-NER) (R-HSA-6781827)
  Dual incision in TC-NER (R-HSA-6782135)
  Gap-filling DNA repair synthesis and ligation in TC-NER (R-HSA-6782210)
  TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648)
  mRNA Capping (R-HSA-72086)
  RNA Polymerase I Transcription Initiation (R-HSA-73762)
  RNA Polymerase I Promoter Escape (R-HSA-73772)
  RNA Polymerase II Promoter Escape (R-HSA-73776)
  RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (R-HSA-73779)
  RNA Polymerase I Transcription Termination (R-HSA-73863)
  RNA Polymerase II Transcription Initiation (R-HSA-75953)
  RNA Polymerase II Transcription Elongation (R-HSA-75955)
  RNA Polymerase II Transcription Initiation And Promoter Clearance (R-HSA-76042)
  RNA Pol II CTD phosphorylation and interaction with CE (R-HSA-77075)
  Formation of RNA Pol II elongation complex (R-HSA-112382)

Molecular Interaction Atlas (MIA) of This DOT

52 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cerebrooculofacioskeletal syndrome 2	DISG9L8Q	Definitive	Autosomal recessive	[1]
Lung neoplasm	DISVARNB	Definitive	Genetic Variation	[2]
Trichothiodystrophy 1, photosensitive	DISK51NL	Definitive	Autosomal recessive	[3]
Xeroderma pigmentosum group D	DISFFE93	Definitive	Autosomal recessive	[4]
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[5]
Adenocarcinoma	DIS3IHTY	Strong	Genetic Variation	[6]
Age-related macular degeneration	DIS0XS2C	Strong	Genetic Variation	[7]
B-cell lymphoma	DISIH1YQ	Strong	Genetic Variation	[8]
Basal cell carcinoma	DIS7PYN3	Strong	Genetic Variation	[9]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[10]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[11]
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[12]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[13]
Chromosomal disorder	DISM5BB5	Strong	Genetic Variation	[14]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[15]
Epidermolytic ichthyosis	DISJPEP3	Strong	Biomarker	[16]
Esophageal adenocarcinoma	DISODWFP	Strong	Genetic Variation	[17]
Esophageal cancer	DISGB2VN	Strong	Genetic Variation	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[19]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[20]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[21]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Strong	Genetic Variation	[22]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[12]
Neoplasm of esophagus	DISOLKAQ	Strong	Genetic Variation	[12]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[22]
Sensorineural hearing loss disorder	DISJV45Z	Strong	Biomarker	[23]
Skin disease	DISDW8R6	Strong	Biomarker	[16]
Skin neoplasm	DIS16DDV	Strong	Biomarker	[16]
Small lymphocytic lymphoma	DIS30POX	Strong	Genetic Variation	[24]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[25]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[25]
Xeroderma pigmentosum group A	DIS38HWC	Strong	Genetic Variation	[26]
Colorectal neoplasm	DISR1UCN	moderate	Genetic Variation	[27]
Gastric neoplasm	DISOKN4Y	moderate	Genetic Variation	[20]
Melanocytic nevus	DISYS32D	moderate	Genetic Variation	[28]
Sarcoma	DISZDG3U	Moderate	Autosomal recessive	[29]
Squamous cell carcinoma	DISQVIFL	moderate	Genetic Variation	[30]
COFS syndrome	DISTEABI	Supportive	Autosomal recessive	[1]
Trichothiodystrophy	DISOMQD2	Supportive	Autosomal recessive	[31]
Xeroderma pigmentosum	DISQ9H19	Supportive	Autosomal recessive	[32]
Xeroderma pigmentosum-Cockayne syndrome complex	DISJ0QRY	Supportive	Autosomal recessive	[32]
Bone osteosarcoma	DIST1004	Limited	Genetic Variation	[33]
Cataract	DISUD7SL	Limited	Biomarker	[34]
Cockayne syndrome	DISW6GL2	Limited	Biomarker	[35]
Colon carcinoma	DISJYKUO	Limited	Altered Expression	[36]
Endometrial cancer	DISW0LMR	Limited	Genetic Variation	[37]
Endometrial carcinoma	DISXR5CY	Limited	Genetic Variation	[37]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[38]
Leukemia	DISNAKFL	Limited	Genetic Variation	[39]
Osteosarcoma	DISLQ7E2	Limited	Genetic Variation	[33]
Prostate neoplasm	DISHDKGQ	Limited	Genetic Variation	[40]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2) increases the response to substance of Arsenic.	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2) affects the response to substance of Benzo(a)pyrene.	[56]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[41]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[42]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[44]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[45]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[46]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[47]
Menthol	DMG2KW7	Approved	Menthol increases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[48]
Beta-carotene	DM0RXBT	Approved	Beta-carotene decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[49]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[45]
Arecoline	DMFJZK3	Phase 1	Arecoline decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[51]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[52]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[53]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2).	[54]

References

• [1] Cerebro-oculo-facio-skeletal syndrome with a nucleotide excision-repair defect and a mutated XPD gene, with prenatal diagnosis in a triplet pregnancy. Am J Hum Genet. 2001 Aug;69(2):291-300. doi: 10.1086/321295. Epub 2001 Jul 3.
• [2] Genetic polymorphisms in the DNA repair genes XPD and XRCC1, p53 gene mutations and bladder cancer risk.Oncol Rep. 2010 Jul;24(1):257-62. doi: 10.3892/or_00000854.
• [3] Genotype-phenotype relationships in trichothiodystrophy patients with novel splicing mutations in the XPD gene. Hum Mutat. 2009 Mar;30(3):438-45. doi: 10.1002/humu.20912.
• [4] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [5] Acute megakaryoblastic leukemia in a patient with xeroderma pigmentosum: discussion of pathophysiological, prognostic, and toxicological aspects.Acta Haematol. 2013;129(2):121-5. doi: 10.1159/000342897. Epub 2012 Nov 28.
• [6] Genetic polymorphisms in DNA repair genes XPC, XPD, and XRCC4, and susceptibility to Helicobacter pylori infection-related gastric antrum adenocarcinoma in Guangxi population, China.Mol Carcinog. 2010 Jun;49(6):611-8. doi: 10.1002/mc.20630.
• [7] Genetic variability in DNA repair proteins in age-related macular degeneration.Int J Mol Sci. 2012 Oct 18;13(10):13378-97. doi: 10.3390/ijms131013378.
• [8] Association of ERCC2 Gene Polymorphisms with Susceptibility to Diffuse Large B-Cell Lymphoma.Med Sci Monit. 2018 Oct 3;24:7015-7022. doi: 10.12659/MSM.908813.
• [9] Polymorphism in the nuclear excision repair gene ERCC2/XPD: association between an exon 6-exon 10 haplotype and susceptibility to cutaneous basal cell carcinoma.Hum Mutat. 2005 Apr;25(4):353-9. doi: 10.1002/humu.20158.
• [10] Polymorphism of DNA repair genes OGG1, XRCC1, XPD and ERCC6 in bladder cancer in Belarus.Biomarkers. 2014 Sep;19(6):509-16. doi: 10.3109/1354750X.2014.943291. Epub 2014 Aug 4.
• [11] DNA repair gene ERCC2 polymorphisms and associations with breast and ovarian cancer risk.Mol Cancer. 2008 May 2;7:36. doi: 10.1186/1476-4598-7-36.
• [12] Association Between ERCC1 rs3212986 and ERCC2/XPD rs1799793 and OS in Patients With Advanced Esophageal Cancer.Front Oncol. 2019 Feb 21;9:85. doi: 10.3389/fonc.2019.00085. eCollection 2019.
• [13] Decreased expression of DNA repair genes (XRCC1, ERCC1, ERCC2, and ERCC4) in squamous intraepithelial lesion and invasive squamous cell carcinoma of the cervix.Mol Cell Biochem. 2013 May;377(1-2):45-53. doi: 10.1007/s11010-013-1569-y. Epub 2013 Feb 23.
• [14] Evaluating chromosomal damage in workers exposed to hexavalent chromium and the modulating role of polymorphisms of DNA repair genes.Int Arch Occup Environ Health. 2012 Jul;85(5):473-81. doi: 10.1007/s00420-011-0684-x. Epub 2011 Aug 20.
• [15] RRM1, RRM2 and ERCC2 Gene Polymorphisms in Coronary Artery Disease.In Vivo. 2016 09-10;30(5):611-5.
• [16] Polymorphism in the ERCC2 codon 751 is associated with arsenic-induced premalignant hyperkeratosis and significant chromosome aberrations. Carcinogenesis. 2007 Mar;28(3):672-6. doi: 10.1093/carcin/bgl181. Epub 2006 Oct 17.
• [17] A pooled analysis of the ERCC2 Asp312Asn polymorphism and esophageal cancer susceptibility.Tumour Biol. 2014 Apr;35(4):2959-65. doi: 10.1007/s13277-013-1380-0.
• [18] Genetic risk of subsequent esophageal cancer in lymphoma and breast cancer long-term survival patients: a pilot study.Pharmacogenomics J. 2016 Jun;16(3):266-71. doi: 10.1038/tpj.2015.41. Epub 2015 Jun 9.
• [19] XPD suppresses cell proliferation and migration via miR-29a-3p-Mdm2/PDGF-B axis in HCC.Cell Biosci. 2019 Jan 5;9:6. doi: 10.1186/s13578-018-0269-4. eCollection 2019.
• [20] Xeroderma pigmentosum group D 751 polymorphism as a predictive factor in resected gastric cancer treated with chemo-radiotherapy.World J Gastroenterol. 2006 Oct 7;12(37):6032-6. doi: 10.3748/wjg.v12.i37.6032.
• [21] Genetic predisposition to lung adenocarcinoma among never-smoking Chinese with different epidermal growth factor receptor mutation status.Lung Cancer. 2017 Dec;114:79-89. doi: 10.1016/j.lungcan.2017.10.012. Epub 2017 Oct 31.
• [22] Association between the ERCC2 Asp312Asn polymorphism and risk of cancer.Oncotarget. 2017 Jul 18;8(29):48488-48506. doi: 10.18632/oncotarget.17290.
• [23] Histopathology of the inner ear in patients with xeroderma pigmentosum and neurologic degeneration.Otol Neurotol. 2013 Sep;34(7):1230-6. doi: 10.1097/MAO.0b013e31829795e9.
• [24] DNA repair polymorphisms in B-cell chronic lymphocytic leukemia in sufferers of Chernobyl Nuclear Power Plant accident.J Radiat Res. 2012;53(3):497-503. doi: 10.1269/jrr.11093.
• [25] Somatic ERCC2 mutations are associated with a distinct genomic signature in urothelial tumors.Nat Genet. 2016 Jun;48(6):600-606. doi: 10.1038/ng.3557. Epub 2016 Apr 25.
• [26] Insulin-like growth factors II exon 9 and E-cadherin-Pml I but not myeloperoxidase promoter-463, urokinase-ApaL I nor xeroderma pigmentosum polymorphisms are associated with higher susceptibility to leiomyoma.Anticancer Res. 2010 Jun;30(6):2203-8.
• [27] ERCC2 2251A>C genetic polymorphism was highly correlated with early relapse in high-risk stage II and stage III colorectal cancer patients: a preliminary study.BMC Cancer. 2008 Feb 12;8:50. doi: 10.1186/1471-2407-8-50.
• [28] XPD gene polymorphism and host characteristics in the association with cutaneous malignant melanoma risk.Br J Cancer. 2004 Jan 26;90(2):497-502. doi: 10.1038/sj.bjc.6601385.
• [29] Monogenic and polygenic determinants of sarcoma risk: an international genetic study. Lancet Oncol. 2016 Sep;17(9):1261-71. doi: 10.1016/S1470-2045(16)30147-4. Epub 2016 Aug 4.
• [30] Are XPD and XPG gene variants related to the mechanism of oral squamous cell carcinoma?.Cell Mol Biol (Noisy-le-grand). 2018 Dec 31;64(15):94-99.
• [31] Reduced level of the repair/transcription factor TFIIH in trichothiodystrophy. Hum Mol Genet. 2002 Nov 1;11(23):2919-28. doi: 10.1093/hmg/11.23.2919.
• [32] Xeroderma Pigmentosum. 2003 Jun 20 [updated 2022 Mar 24]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [33] ERCC polymorphisms and risk of osteosarcoma: a meta-analysis.Eur Rev Med Pharmacol Sci. 2018 Oct;22(20):6658-6666. doi: 10.26355/eurrev_201810_16142.
• [34] XRCC1 and XPD genetic polymorphisms and susceptibility to age-related cataract: a meta-analysis.Mol Vis. 2015 Mar 30;21:335-46. eCollection 2015.
• [35] Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.Nat Struct Mol Biol. 2019 Jun;26(6):397-406. doi: 10.1038/s41594-019-0220-3. Epub 2019 May 20.
• [36] The Differential Expression of Core Genes in Nucleotide Excision Repair Pathway Indicates Colorectal Carcinogenesis and Prognosis.Biomed Res Int. 2018 Jan 15;2018:9651320. doi: 10.1155/2018/9651320. eCollection 2018.
• [37] The R156R ERCC2 polymorphism as a risk factor of endometrial cancer.Tumour Biol. 2016 Feb;37(2):2171-6. doi: 10.1007/s13277-015-4040-8. Epub 2015 Sep 9.
• [38] Lethality in yeast of trichothiodystrophy (TTD) mutations in the human xeroderma pigmentosum group D gene. Implications for transcriptional defect in TTD.J Biol Chem. 1995 Jul 28;270(30):17660-3. doi: 10.1074/jbc.270.30.17660.
• [39] Polymorphisms in XPC, XPD and XPG DNA repair genes and leukemia risk in a Tunisian population.Leuk Lymphoma. 2015 Jun;56(6):1856-62. doi: 10.3109/10428194.2014.974045. Epub 2014 Nov 14.
• [40] Association of XPD polymorphisms with prostate cancer in Taiwanese patients.Anticancer Res. 2007 Jul-Aug;27(4C):2893-6.
• [41] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [42] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [43] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [44] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [45] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [46] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [47] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [48] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [49] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [50] Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
• [51] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [52] Comparison of the global gene expression profiles produced by methylparaben, n-butylparaben and 17beta-oestradiol in MCF7 human breast cancer cells. J Appl Toxicol. 2007 Jan-Feb;27(1):67-77. doi: 10.1002/jat.1200.
• [53] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [54] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [55] Polymorphism in the ERCC2 codon 751 is associated with arsenic-induced premalignant hyperkeratosis and significant chromosome aberrations. Carcinogenesis. 2007 Mar;28(3):672-6. doi: 10.1093/carcin/bgl181. Epub 2006 Oct 17.
• [56] DNA repair gene deficiency does not predispose human bronchial epithelial cells to benzo(a)pyrene-induced cell transformation. Toxicol In Vitro. 2012 Jun;26(4):579-84. doi: 10.1016/j.tiv.2012.02.002. Epub 2012 Feb 22.