Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1KKXC8)

DOT Name	Neurensin-1 (NRSN1)
Synonyms	Neuro-p24; Vesicular membrane protein of 24 kDa; Vesicular membrane protein p24
Gene Name	NRSN1
Related Disease	Neoplasm ( ) Adult T-cell leukemia/lymphoma ( ) Attention deficit hyperactivity disorder ( ) Chorioamnionitis ( ) Chronic fatigue syndrome ( ) Colon carcinoma ( ) Cytomegalovirus infection ( ) Hepatitis D virus infection ( ) Immunodeficiency ( ) Influenza ( ) Large cell lymphoma ( ) Leukemia ( ) Lyme disease ( ) Lymphoma ( ) Mental disorder ( ) Myelopathy ( ) Polyneuropathy ( ) Progressive multifocal leukoencephalopathy ( ) Pulmonary disease ( ) Schizophrenia ( ) Sjogren syndrome ( ) Spastic paralysis ( ) T-cell leukaemia ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Urticaria ( ) Vibrio cholerae infection ( ) Breast cancer ( ) Breast carcinoma ( ) Neuroblastoma ( ) Plasma cell myeloma ( ) Tuberculosis ( ) Classic Hodgkin lymphoma ( ) Hirschsprung disease ( ) Huntington disease ( ) Malaria ( ) Mood disorder ( ) Psychotic disorder ( ) Rheumatoid arthritis ( )
UniProt ID	NRSN1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14927
Sequence	MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSV FWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGA VLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIP VTLSRVQNVQPLLAT
Function	May play an important role in neural organelle transport, and in transduction of nerve signals or in nerve growth. May play a role in neurite extension. May play a role in memory consolidation.
Tissue Specificity	Expressed in brain. Not detectable in other tissues tested.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[2]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[3]
Chorioamnionitis	DISL1D9U	Strong	Altered Expression	[4]
Chronic fatigue syndrome	DIS34WJ5	Strong	Biomarker	[5]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[6]
Cytomegalovirus infection	DISCEMGC	Strong	Altered Expression	[7]
Hepatitis D virus infection	DISESSLZ	Strong	Biomarker	[8]
Immunodeficiency	DIS093I0	Strong	Biomarker	[9]
Influenza	DIS3PNU3	Strong	Biomarker	[10]
Large cell lymphoma	DISYZHCP	Strong	Altered Expression	[1]
Leukemia	DISNAKFL	Strong	Biomarker	[11]
Lyme disease	DISO70G5	Strong	Altered Expression	[12]
Lymphoma	DISN6V4S	Strong	Biomarker	[13]
Mental disorder	DIS3J5R8	Strong	Biomarker	[14]
Myelopathy	DISXV8FG	Strong	Biomarker	[15]
Polyneuropathy	DISB9G3W	Strong	Genetic Variation	[16]
Progressive multifocal leukoencephalopathy	DISX02WS	Strong	Biomarker	[17]
Pulmonary disease	DIS6060I	Strong	Altered Expression	[18]
Schizophrenia	DISSRV2N	Strong	Biomarker	[14]
Sjogren syndrome	DISUBX7H	Strong	Biomarker	[19]
Spastic paralysis	DISVQ6I2	Strong	Biomarker	[15]
T-cell leukaemia	DISJ6YIF	Strong	Biomarker	[2]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[20]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[20]
Urticaria	DIS9WQAI	Strong	Altered Expression	[21]
Vibrio cholerae infection	DISW7E3U	Strong	Biomarker	[22]
Breast cancer	DIS7DPX1	moderate	Biomarker	[23]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[23]
Neuroblastoma	DISVZBI4	moderate	Genetic Variation	[24]
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[23]
Tuberculosis	DIS2YIMD	moderate	Biomarker	[13]
Classic Hodgkin lymphoma	DISV1LU6	Limited	Biomarker	[25]
Hirschsprung disease	DISUUSM1	Limited	Biomarker	[26]
Huntington disease	DISQPLA4	Limited	Biomarker	[25]
Malaria	DISQ9Y50	Limited	Biomarker	[27]
Mood disorder	DISLVMWO	Limited	Altered Expression	[28]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[28]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[29]
------------------------------------------------------------------------------------


⏷ Show the Full List of 39 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Neurensin-1 (NRSN1).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Neurensin-1 (NRSN1).	[31]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Neurensin-1 (NRSN1).	[33]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Neurensin-1 (NRSN1).	[20]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Neurensin-1 (NRSN1).	[34]
------------------------------------------------------------------------------------

References

1	Identification of a common clonal human immunodeficiency virus integration site in human immunodeficiency virus-associated lymphomas.Cancer Res. 1994 Apr 15;54(8):2069-72.
2	Effect of tumor promoters on human T cell leukemia/lymphoma virus (HTLV)-structural protein induction in adult T-cell leukemia cells.Cancer Lett. 1984 Sep;24(2):129-39. doi: 10.1016/0304-3835(84)90128-9.
3	Association of attention-deficit/hyperactivity disorder with a candidate region for reading disabilities on chromosome 6p.Biol Psychiatry. 2009 Aug 15;66(4):368-75. doi: 10.1016/j.biopsych.2009.02.016. Epub 2009 Apr 11.
4	Risk factors for perinatal transmission of human immunodeficiency virus type 1 in women treated with zidovudine. Pediatric AIDS Clinical Trials Group Study 185 Team.N Engl J Med. 1999 Aug 5;341(6):385-93. doi: 10.1056/NEJM199908053410601.
5	Demonstration of Borna disease virus RNA in peripheral blood mononuclear cells derived from Japanese patients with chronic fatigue syndrome.FEBS Lett. 1996 Jan 8;378(2):145-9. doi: 10.1016/0014-5793(95)01439-x.
6	Productive in vitro infection of human umbilical vein endothelial cells and three colon carcinoma cell lines with HIV-1.Immunol Cell Biol. 1995 Apr;73(2):140-5. doi: 10.1038/icb.1995.22.
7	Human cytomegalovirus infection reduces surface CCR5 expression in human microglial cells, astrocytes and monocyte-derived macrophages.Microbes Infect. 2002 Nov;4(14):1401-8. doi: 10.1016/s1286-4579(02)00022-9.
8	Hepatitis delta virus heterogeneity: a study by immunofluorescence.J Hepatol. 1991;13 Suppl 4:S125-9. doi: 10.1016/0168-8278(91)90043-b.
9	Seroprevalence of hepatitis B, hepatitis C, human immunodeficiency virus, Treponema pallidum, and co-infections among blood donors in Kyrgyzstan: a retrospective analysis (2013-2015).Infect Dis Poverty. 2017 Feb 21;6(1):45. doi: 10.1186/s40249-017-0255-9.
10	IL-13 acutely augments HIV-specific and recall responses from HIV-1-infected subjects in vitro by modulating monocytes.J Immunol. 2005 Oct 15;175(8):5532-40. doi: 10.4049/jimmunol.175.8.5532.
11	Lack of BLV and PTLV DNA sequences in the majority of patients with large granular lymphocyte leukaemia.Br J Haematol. 2000 Apr;109(1):64-70. doi: 10.1046/j.1365-2141.2000.01972.x.
12	Analysis of a VMP-like sequence (vls) locus in Borrelia garinii and Vls homologues among four Borrelia burgdorferi sensu lato species.FEMS Microbiol Lett. 2001 May 15;199(1):39-45. doi: 10.1111/j.1574-6968.2001.tb10648.x.
13	HIV-associated benign lymphoepithelial cysts of the parotid glands confirmed by HIV-1 p24 antigen immunostaining.BMJ Case Rep. 2017 Sep 28;2017:bcr2017221869. doi: 10.1136/bcr-2017-221869.
14	Detection and sequence analysis of borna disease virus p24 RNA from peripheral blood mononuclear cells of patients with mood disorders or schizophrenia and of blood donors.J Virol. 1998 Dec;72(12):10044-9. doi: 10.1128/JVI.72.12.10044-10049.1998.
15	Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using synthetic peptides as antigens.J Clin Microbiol. 1992 Feb;30(2):287-90. doi: 10.1128/jcm.30.2.287-290.1992.
16	Multiple drug combinations of bortezomib, lenalidomide, and thalidomide for first-line treatment in adults with transplant-ineligible multiple myeloma: a network meta-analysis.Cochrane Database Syst Rev. 2019 Nov 25;2019(11):CD013487. doi: 10.1002/14651858.CD013487.
17	Detection of HIV-1 Tat and JCV capsid protein, VP1, in AIDS brain with progressive multifocal leukoencephalopathy.J Neurovirol. 2000 Jun;6(3):221-8. doi: 10.3109/13550280009015824.
18	Mycobacterium tuberculosis enhances human immunodeficiency virus-1 replication in the lung.Am J Respir Crit Care Med. 1997 Mar;155(3):996-1003. doi: 10.1164/ajrccm.155.3.9117038.
19	Retrovirus in salivary glands from patients with Sjgren's syndrome.J Clin Pathol. 1997 Mar;50(3):223-30. doi: 10.1136/jcp.50.3.223.
20	Identification of novel gene targets and putative regulators of arsenic-associated DNA methylation in human urothelial cells and bladder cancer. Chem Res Toxicol. 2015 Jun 15;28(6):1144-55. doi: 10.1021/tx500393y. Epub 2015 Jun 3.
21	Molecular and pathologic insights from latent HIV-1 infection in the human brain.Neurology. 2013 Apr 9;80(15):1415-23. doi: 10.1212/WNL.0b013e31828c2e9e. Epub 2013 Mar 13.
22	Immunogenicity and virulence of attenuated vaccinia virus Tian Tan encoding HIV-1 muti-epitope genes, p24 and cholera toxin B subunit in mice.J Virol Methods. 2015 Jul;219:1-9. doi: 10.1016/j.jviromet.2015.03.007. Epub 2015 Mar 20.
23	Breast cancer and synchronous multiple myeloma as a diagnostic challenge: Case report and review of literature.Curr Probl Cancer. 2018 Mar-Apr;42(2):231-234. doi: 10.1016/j.currproblcancer.2017.11.001. Epub 2017 Nov 22.
24	Two regions of deletion in 9p22- p24 in neuroblastoma are frequently observed in favorable tumors.Cancer Genet Cytogenet. 2002 May;135(1):42-7. doi: 10.1016/s0165-4608(01)00640-9.
25	Identification of novel genes in Hirschsprung disease pathway using whole genome expression study.J Pediatr Surg. 2012 Feb;47(2):303-7. doi: 10.1016/j.jpedsurg.2011.11.017.
26	Common genetic variants in GAL, GAP43 and NRSN1 and interaction networks confer susceptibility to Hirschsprung disease.J Cell Mol Med. 2018 Jul;22(7):3377-3387. doi: 10.1111/jcmm.13612. Epub 2018 Apr 14.
27	Malaria infection induces virus expression in human immunodeficiency virus transgenic mice by CD4 T cell-dependent immune activation.J Infect Dis. 2001 Apr 15;183(8):1260-8. doi: 10.1086/319686. Epub 2001 Mar 9.
28	Detection of Borna disease virus p24 RNA in peripheral blood cells from Brazilian mood and psychotic disorder patients.J Affect Disord. 2006 Jan;90(1):43-7. doi: 10.1016/j.jad.2005.10.008. Epub 2005 Dec 1.
29	Cellular basis and oncogene expression of rheumatoid joint destruction.Rheumatol Int. 1989;9(3-5):105-13. doi: 10.1007/BF00271866.
30	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
31	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
32	Identification of novel gene targets and putative regulators of arsenic-associated DNA methylation in human urothelial cells and bladder cancer. Chem Res Toxicol. 2015 Jun 15;28(6):1144-55. doi: 10.1021/tx500393y. Epub 2015 Jun 3.
33	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
34	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.