Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1MCP2F)

DOT Name Actin, cytoplasmic 1 (ACTB)
Synonyms EC 3.6.4.-; Beta-actin
Gene Name ACTB
Related Disease
Baraitser-Winter cerebrofrontofacial syndrome ( )
Baraitser-Winter syndrome 1 ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Metastatic malignant neoplasm ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Bipolar disorder ( )
Breast cancer ( )
Breast carcinoma ( )
Cataract ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Congenital nervous system disorder ( )
Developmental malformations-deafness-dystonia syndrome ( )
Dysplasia ( )
Dystonia ( )
Glioblastoma multiforme ( )
High blood pressure ( )
Immunodeficiency ( )
Inherited bleeding disorder, platelet-type ( )
Intellectual disability ( )
Melanoma ( )
Myocardial ischemia ( )
Non-small-cell lung cancer ( )
Osteoarthritis ( )
Paroxysmal dystonia ( )
Patent ductus arteriosus ( )
Ptosis ( )
Rheumatoid arthritis ( )
Schizophrenia ( )
Sensorineural hearing loss disorder ( )
Temporal lobe epilepsy ( )
ACTB-associated syndromic thrombocytopenia ( )
Breast neoplasm ( )
Coloboma ( )
Cryptorchidism ( )
Isolated congenital microcephaly ( )
Undifferentiated carcinoma ( )
Esophageal cancer ( )
Neoplasm of esophagus ( )
Neuroblastoma ( )
UniProt ID
ACTB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3BYH ; 3D2U ; 3J82 ; 3LUE ; 6ANU ; 6ICT ; 6ICV ; 6LTJ ; 6MBJ ; 6MBK ; 6MBL ; 6NBW ; 6OX0 ; 6OX1 ; 6OX2 ; 6OX3 ; 6OX4 ; 6OX5 ; 6V62 ; 6V63 ; 6WK1 ; 6WK2 ; 7AS4 ; 7P1H ; 7QJ6 ; 7QJ9 ; 7VDV ; 7W28 ; 7W29 ; 7Y8R ; 7ZTC ; 7ZTD ; 8DNH ; 8OI8 ; 8OID
EC Number
3.6.4.-
Pfam ID
PF00022
Sequence
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
Function
Actin is a highly conserved protein that polymerizes to produce filaments that form cross-linked networks in the cytoplasm of cells. Actin exists in both monomeric (G-actin) and polymeric (F-actin) forms, both forms playing key functions, such as cell motility and contraction. In addition to their role in the cytoplasmic cytoskeleton, G- and F-actin also localize in the nucleus, and regulate gene transcription and motility and repair of damaged DNA. Part of the ACTR1A/ACTB filament around which the dynactin complex is built. The dynactin multiprotein complex activates the molecular motor dynein for ultra-processive transport along microtubules.
KEGG Pathway
ATP-dependent chromatin remodeling (hsa03082 )
Rap1 sig.ling pathway (hsa04015 )
Phagosome (hsa04145 )
Apoptosis (hsa04210 )
Hippo sig.ling pathway (hsa04390 )
Focal adhesion (hsa04510 )
Adherens junction (hsa04520 )
Tight junction (hsa04530 )
Platelet activation (hsa04611 )
Neutrophil extracellular trap formation (hsa04613 )
Leukocyte transendothelial migration (hsa04670 )
Thermogenesis (hsa04714 )
Regulation of actin cytoskeleton (hsa04810 )
Motor proteins (hsa04814 )
Cytoskeleton in muscle cells (hsa04820 )
Thyroid hormone sig.ling pathway (hsa04919 )
Oxytocin sig.ling pathway (hsa04921 )
Gastric acid secretion (hsa04971 )
Amyotrophic lateral sclerosis (hsa05014 )
Bacterial invasion of epithelial cells (hsa05100 )
Vibrio cholerae infection (hsa05110 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Yersinia infection (hsa05135 )
Influenza A (hsa05164 )
Proteoglycans in cancer (hsa05205 )
Hepatocellular carcinoma (hsa05225 )
Hypertrophic cardiomyopathy (hsa05410 )
Arrhythmogenic right ventricular cardiomyopathy (hsa05412 )
Dilated cardiomyopathy (hsa05414 )
Viral myocarditis (hsa05416 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
Gap junction degradation (R-HSA-190873 )
Formation of annular gap junctions (R-HSA-196025 )
Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482 )
HATs acetylate histones (R-HSA-3214847 )
Prefoldin mediated transfer of substrate to CCT/TriC (R-HSA-389957 )
Folding of actin by CCT/TriC (R-HSA-390450 )
EPHB-mediated forward signaling (R-HSA-3928662 )
EPH-ephrin mediated repulsion of cells (R-HSA-3928665 )
Adherens junctions interactions (R-HSA-418990 )
Recycling pathway of L1 (R-HSA-437239 )
VEGFA-VEGFR2 Pathway (R-HSA-4420097 )
Interaction between L1 and Ankyrins (R-HSA-445095 )
Cell-extracellular matrix interactions (R-HSA-446353 )
B-WICH complex positively regulates rRNA expression (R-HSA-5250924 )
RHO GTPases activate IQGAPs (R-HSA-5626467 )
RHO GTPases Activate WASPs and WAVEs (R-HSA-5663213 )
RHO GTPases Activate Formins (R-HSA-5663220 )
MAP2K and MAPK activation (R-HSA-5674135 )
UCH proteinases (R-HSA-5689603 )
DNA Damage Recognition in GG-NER (R-HSA-5696394 )
Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946 )
Signaling by high-kinase activity BRAF mutants (R-HSA-6802948 )
Signaling by BRAF and RAF1 fusions (R-HSA-6802952 )
Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955 )
Clathrin-mediated endocytosis (R-HSA-8856828 )
RHOF GTPase cycle (R-HSA-9035034 )
Signaling downstream of RAS mutants (R-HSA-9649948 )
Signaling by RAF1 mutants (R-HSA-9656223 )
Sensory processing of sound by inner hair cells of the cochlea (R-HSA-9662360 )
Sensory processing of sound by outer hair cells of the cochlea (R-HSA-9662361 )
FCGR3A-mediated phagocytosis (R-HSA-9664422 )
Factors involved in megakaryocyte development and platelet production (R-HSA-983231 )
Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Baraitser-Winter cerebrofrontofacial syndrome DISN13U9 Definitive Autosomal dominant [1]
Baraitser-Winter syndrome 1 DIS5CQYZ Definitive Autosomal dominant [2]
Lung cancer DISCM4YA Definitive Biomarker [3]
Lung carcinoma DISTR26C Definitive Biomarker [3]
Lung neoplasm DISVARNB Definitive Biomarker [4]
Metastatic malignant neoplasm DIS86UK6 Definitive Biomarker [5]
Adult glioblastoma DISVP4LU Strong Biomarker [6]
Advanced cancer DISAT1Z9 Strong Biomarker [7]
Alzheimer disease DISF8S70 Strong Altered Expression [8]
Bipolar disorder DISAM7J2 Strong Biomarker [9]
Breast cancer DIS7DPX1 Strong Biomarker [10]
Breast carcinoma DIS2UE88 Strong Biomarker [10]
Cataract DISUD7SL Strong Altered Expression [11]
Colon carcinoma DISJYKUO Strong Biomarker [12]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [13]
Congenital nervous system disorder DIS2BIP8 Strong Biomarker [14]
Developmental malformations-deafness-dystonia syndrome DISCS85P Strong Autosomal dominant [15]
Dysplasia DISHPNVX Strong Biomarker [16]
Dystonia DISJLFGW Strong Genetic Variation [17]
Glioblastoma multiforme DISK8246 Strong Biomarker [6]
High blood pressure DISY2OHH Strong Biomarker [18]
Immunodeficiency DIS093I0 Strong Biomarker [19]
Inherited bleeding disorder, platelet-type DISIUNXT Strong Biomarker [20]
Intellectual disability DISMBNXP Strong Biomarker [21]
Melanoma DIS1RRCY Strong Altered Expression [22]
Myocardial ischemia DISFTVXF Strong Biomarker [23]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [24]
Osteoarthritis DIS05URM Strong Altered Expression [25]
Paroxysmal dystonia DISV0MSQ Strong Biomarker [16]
Patent ductus arteriosus DIS9P8YS Strong Biomarker [26]
Ptosis DISJZNIY Strong Genetic Variation [27]
Rheumatoid arthritis DISTSB4J Strong Biomarker [28]
Schizophrenia DISSRV2N Strong Altered Expression [29]
Sensorineural hearing loss disorder DISJV45Z Strong Biomarker [16]
Temporal lobe epilepsy DISNOPXX Strong Biomarker [30]
ACTB-associated syndromic thrombocytopenia DISKSVDR Moderate Autosomal dominant [1]
Breast neoplasm DISNGJLM moderate Biomarker [31]
Coloboma DISP39N5 moderate Genetic Variation [32]
Cryptorchidism DISYUD2P moderate Biomarker [33]
Isolated congenital microcephaly DISUXHZ6 moderate Genetic Variation [34]
Undifferentiated carcinoma DISIAZST Disputed Biomarker [35]
Esophageal cancer DISGB2VN Limited Biomarker [36]
Neoplasm of esophagus DISOLKAQ Limited Biomarker [36]
Neuroblastoma DISVZBI4 Limited Biomarker [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
PEITC DMOMN31 Phase 2 Actin, cytoplasmic 1 (ACTB) affects the binding of PEITC. [76]
Sulforaphane DMQY3L0 Investigative Actin, cytoplasmic 1 (ACTB) affects the binding of Sulforaphane. [76]
4-hydroxy-2-nonenal DM2LJFZ Investigative Actin, cytoplasmic 1 (ACTB) affects the binding of 4-hydroxy-2-nonenal. [77]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Actin, cytoplasmic 1 (ACTB). [38]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Actin, cytoplasmic 1 (ACTB). [65]
------------------------------------------------------------------------------------
38 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Actin, cytoplasmic 1 (ACTB). [39]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Actin, cytoplasmic 1 (ACTB). [40]
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Actin, cytoplasmic 1 (ACTB). [41]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Actin, cytoplasmic 1 (ACTB). [42]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Actin, cytoplasmic 1 (ACTB). [43]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Actin, cytoplasmic 1 (ACTB). [44]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Actin, cytoplasmic 1 (ACTB). [39]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Actin, cytoplasmic 1 (ACTB). [45]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Actin, cytoplasmic 1 (ACTB). [46]
Selenium DM25CGV Approved Selenium increases the expression of Actin, cytoplasmic 1 (ACTB). [47]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Actin, cytoplasmic 1 (ACTB). [48]
Clozapine DMFC71L Approved Clozapine decreases the expression of Actin, cytoplasmic 1 (ACTB). [49]
Menthol DMG2KW7 Approved Menthol decreases the expression of Actin, cytoplasmic 1 (ACTB). [50]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide decreases the expression of Actin, cytoplasmic 1 (ACTB). [51]
Mifepristone DMGZQEF Approved Mifepristone decreases the expression of Actin, cytoplasmic 1 (ACTB). [52]
Dopamine DMPGUCF Approved Dopamine affects the expression of Actin, cytoplasmic 1 (ACTB). [53]
Etretinate DM2CZFA Approved Etretinate increases the expression of Actin, cytoplasmic 1 (ACTB). [54]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Actin, cytoplasmic 1 (ACTB). [55]
Rigosertib DMOSTXF Phase 3 Rigosertib increases the expression of Actin, cytoplasmic 1 (ACTB). [56]
Napabucasin DMDZ6Q3 Phase 3 Napabucasin decreases the expression of Actin, cytoplasmic 1 (ACTB). [57]
Nabiximols DMHKJ5I Phase 3 Nabiximols decreases the expression of Actin, cytoplasmic 1 (ACTB). [58]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Actin, cytoplasmic 1 (ACTB). [59]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Actin, cytoplasmic 1 (ACTB). [47]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Actin, cytoplasmic 1 (ACTB). [61]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Actin, cytoplasmic 1 (ACTB). [62]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the expression of Actin, cytoplasmic 1 (ACTB). [55]
MG-132 DMKA2YS Preclinical MG-132 decreases the expression of Actin, cytoplasmic 1 (ACTB). [63]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Actin, cytoplasmic 1 (ACTB). [64]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Actin, cytoplasmic 1 (ACTB). [66]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Actin, cytoplasmic 1 (ACTB). [67]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Actin, cytoplasmic 1 (ACTB). [68]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Actin, cytoplasmic 1 (ACTB). [69]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Actin, cytoplasmic 1 (ACTB). [70]
D-glucose DMMG2TO Investigative D-glucose decreases the expression of Actin, cytoplasmic 1 (ACTB). [71]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Actin, cytoplasmic 1 (ACTB). [72]
Paraoxon DMN4ZKC Investigative Paraoxon increases the expression of Actin, cytoplasmic 1 (ACTB). [73]
9-hydroxyoctadecadienoic acid DM0FWNJ Investigative 9-hydroxyoctadecadienoic acid increases the expression of Actin, cytoplasmic 1 (ACTB). [74]
Indirubin-3'-monoxime DMLRQH0 Investigative Indirubin-3'-monoxime affects the expression of Actin, cytoplasmic 1 (ACTB). [75]
------------------------------------------------------------------------------------
⏷ Show the Full List of 38 Drug(s)
2 Drug(s) Affected the Biochemical Pathways of This DOT
Drug Name Drug ID Highest Status Interaction REF
DNCB DMDTVYC Phase 2 DNCB increases the metabolism of Actin, cytoplasmic 1 (ACTB). [60]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the metabolism of Actin, cytoplasmic 1 (ACTB). [60]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Baraitser-Winter cerebrofrontofacial syndrome: delineation of the spectrum in 42 cases. Eur J Hum Genet. 2015 Mar;23(3):292-301. doi: 10.1038/ejhg.2014.95. Epub 2014 Jul 23.
3 PTPN3 suppresses lung cancer cell invasiveness by counteracting Src-mediated DAAM1 activation and actin polymerization.Oncogene. 2019 Oct;38(44):7002-7016. doi: 10.1038/s41388-019-0948-6. Epub 2019 Aug 12.
4 Proteomic analysis of differentially expressed proteins in lung cancer in Wistar rats using NNK as an inducer.Chem Biol Interact. 2013 Jul 5;204(2):125-34. doi: 10.1016/j.cbi.2013.05.004. Epub 2013 May 18.
5 Changes in Vasodilator-Stimulated Phosphoprotein Phosphorylation, Profilin-1, and Cofilin-1 in Accreta and Protection by DHA.Reprod Sci. 2019 Jun;26(6):757-765. doi: 10.1177/1933719118792095. Epub 2018 Aug 9.
6 On the influence of cannabinoids on cell morphology and motility of glioblastoma cells.PLoS One. 2019 Feb 12;14(2):e0212037. doi: 10.1371/journal.pone.0212037. eCollection 2019.
7 Mutant ACTB mRNA 3'-UTR promotes hepatocellular carcinoma development by regulating miR-1 and miR-29a.Cell Signal. 2020 Mar;67:109479. doi: 10.1016/j.cellsig.2019.109479. Epub 2019 Dec 14.
8 Changes of hippocampus proteomic profiles after blueberry extracts supplementation in APP/PS1 transgenic mice.Nutr Neurosci. 2020 Jan;23(1):75-84. doi: 10.1080/1028415X.2018.1471251. Epub 2018 May 21.
9 Transcriptome sequencing and genome-wide association analyses reveal lysosomal function and actin cytoskeleton remodeling in schizophrenia and bipolar disorder.Mol Psychiatry. 2015 May;20(5):563-572. doi: 10.1038/mp.2014.82. Epub 2014 Aug 12.
10 Involvement of Actin Cytoskeletal Components in Breast Cancer Cell Fusion with Human Mesenchymal Stroma/Stem-Like Cells.Int J Mol Sci. 2019 Feb 18;20(4):876. doi: 10.3390/ijms20040876.
11 Effects of antioxidant supplementation on mRNA expression of glucose-6-phosphate dehydrogenase, -actin and 18S rRNA in the anterior capsule of the lens in cataract patients.Exp Eye Res. 2012 Mar;96(1):48-54. doi: 10.1016/j.exer.2012.01.001. Epub 2012 Jan 20.
12 PRP4 kinase induces actin rearrangement and epithelial-mesenchymal transition through modulation of the actin-binding protein cofilin.Exp Cell Res. 2018 Aug 1;369(1):158-165. doi: 10.1016/j.yexcr.2018.05.018. Epub 2018 May 19.
13 Cancer-associated fibroblasts promote colorectal cancer progression by secreting CLEC3B.Cancer Biol Ther. 2019;20(7):967-978. doi: 10.1080/15384047.2019.1591122. Epub 2019 Mar 20.
14 De novo mutations in the actin genes ACTB and ACTG1 cause Baraitser-Winter syndrome. Nat Genet. 2012 Feb 26;44(4):440-4, S1-2. doi: 10.1038/ng.1091.
15 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
16 A mutation of beta -actin that alters depolymerization dynamics is associated with autosomal dominant developmental malformations, deafness, and dystonia. Am J Hum Genet. 2006 Jun;78(6):947-60. doi: 10.1086/504271. Epub 2006 Apr 21.
17 Dystonia-deafness syndrome caused by ACTB p.Arg183Trp heterozygosity shows striatal dopaminergic dysfunction and response to pallidal stimulation.J Neurodev Disord. 2018 May 22;10(1):17. doi: 10.1186/s11689-018-9235-z.
18 The ACTB Variants and Alcohol Drinking Confer Joint Effect to Ischemic Stroke in Chinese Han Population.J Atheroscler Thromb. 2020 Mar 1;27(3):226-244. doi: 10.5551/jat.49536. Epub 2019 Jul 19.
19 Real-time imaging of individual virion-triggered cortical actin dynamics for human immunodeficiency virus entry into resting CD4 T cells.Nanoscale. 2020 Jan 7;12(1):115-129. doi: 10.1039/c9nr07359k. Epub 2019 Nov 27.
20 Twinfilin 2a regulates platelet reactivity and turnover in mice.Blood. 2017 Oct 12;130(15):1746-1756. doi: 10.1182/blood-2017-02-770768. Epub 2017 Jul 25.
21 Whole-Transcriptome Analysis Reveals Dysregulation of Actin-Cytoskeleton Pathway in Intellectual Disability Patients.Neuroscience. 2019 Apr 15;404:423-444. doi: 10.1016/j.neuroscience.2019.01.029. Epub 2019 Feb 10.
22 Identification of robust reference genes for studies of gene expression in FFPE melanoma samples and melanoma cell lines.Melanoma Res. 2020 Feb;30(1):26-38. doi: 10.1097/CMR.0000000000000644.
23 Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
24 Serological Assessment of Activated Fibroblasts by alpha-Smooth Muscle Actin (-SMA): A Noninvasive Biomarker of Activated Fibroblasts in Lung Disorders.Transl Oncol. 2019 Feb;12(2):368-374. doi: 10.1016/j.tranon.2018.11.004. Epub 2018 Nov 30.
25 Identification of DNA hydroxymethylation associated genes in osteoarthritis by combined analysis of hydroxymethylation and gene expression.J Orthop Sci. 2020 Jul;25(4):700-707. doi: 10.1016/j.jos.2019.09.011. Epub 2019 Oct 25.
26 Congenital heart defects are rarely caused by mutations in cardiac and smooth muscle actin genes.Biomed Res Int. 2015;2015:127807. doi: 10.1155/2015/127807. Epub 2015 Mar 10.
27 Severe forms of Baraitser-Winter syndrome are caused by ACTB mutations rather than ACTG1 mutations.Eur J Hum Genet. 2014 Feb;22(2):179-83. doi: 10.1038/ejhg.2013.130. Epub 2013 Jun 12.
28 Counter-regulation of regulatory T cells by autoreactive CD8(+) T cells in rheumatoid arthritis.J Autoimmun. 2019 May;99:81-97. doi: 10.1016/j.jaut.2019.02.001. Epub 2019 Feb 16.
29 Dysregulated Prefrontal Cortical RhoA Signal Transduction in Bipolar Disorder with Psychosis: New Implications for Disease Pathophysiology.Cereb Cortex. 2020 Jan 10;30(1):59-71. doi: 10.1093/cercor/bhz070.
30 Kainate-induced seizures alter protein composition and N-methyl-D-aspartate receptor function of rat forebrain postsynaptic densities.Neuroscience. 2001;102(1):65-74. doi: 10.1016/s0306-4522(00)00469-3.
31 Carcinoma associated fibroblasts (CAFs) promote breast cancer motility by suppressing mammalian Diaphanous-related formin-2 (mDia2).PLoS One. 2018 Mar 29;13(3):e0195278. doi: 10.1371/journal.pone.0195278. eCollection 2018.
32 A recurrent de novo mutation in ACTG1 causes isolated ocular coloboma.Hum Mutat. 2017 Aug;38(8):942-946. doi: 10.1002/humu.23246. Epub 2017 Jun 6.
33 Exomic and Epigenomic Analyses in a Pair of Monozygotic Twins Discordant for Cryptorchidism.Twin Res Hum Genet. 2017 Aug;20(4):349-354. doi: 10.1017/thg.2017.33. Epub 2017 Jun 13.
34 7p22.1 microdeletions involving ACTB associated with developmental delay, short stature, and microcephaly.Eur J Med Genet. 2016 Oct;59(10):502-6. doi: 10.1016/j.ejmg.2016.09.008. Epub 2016 Sep 12.
35 Global gene expression profiling of chemically induced rat mammary gland carcinomas and adenomas.Toxicol Pathol. 2005;33(7):768-75. doi: 10.1080/01926230500437027.
36 Expression of basic fibroblast growth factor, CD31, and -smooth muscle actin and esophageal cancer recurrence after definitive chemoradiation.Tumour Biol. 2014 Jul;35(7):7275-82. doi: 10.1007/s13277-014-1987-9. Epub 2014 Apr 29.
37 Adult neuroblastoma in the retroperitoneum: A case report.Medicine (Baltimore). 2018 Dec;97(51):e13750. doi: 10.1097/MD.0000000000013750.
38 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
39 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
40 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
41 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
42 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
43 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
44 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
45 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
46 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
47 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
48 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
49 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
50 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
51 Effect of cyclophosphamide on gene expression of cytochromes p450 and beta-actin in the HL-60 cell line. Eur J Pharmacol. 2002 Aug 9;449(3):197-205.
52 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
53 Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
54 Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
55 Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
56 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
57 Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
58 Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
59 A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
60 Determination of Protein Haptenation by Chemical Sensitizers Within the Complexity of the Human Skin Proteome. Toxicol Sci. 2018 Apr 1;162(2):429-438. doi: 10.1093/toxsci/kfx265.
61 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
62 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
63 Inhibition of the 26S proteasome blocks progesterone receptor-dependent transcription through failed recruitment of RNA polymerase II. J Steroid Biochem Mol Biol. 2005 Mar;94(4):337-46.
64 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
65 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
66 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
67 Annexin A3 may play an important role in ochratoxin-induced malignant transformation of human gastric epithelium cells. Toxicol Lett. 2019 Oct 1;313:150-158. doi: 10.1016/j.toxlet.2019.07.002. Epub 2019 Jul 2.
68 Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
69 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
70 Effect of metals on -actin and total protein synthesis in cultured human intestinal epithelial cells. J Pharmacol Toxicol Methods. 2011 Jan-Feb;63(1):47-58. doi: 10.1016/j.vascn.2010.04.012. Epub 2010 May 6.
71 Proteomic analysis of proteins associated with cellular senescence by calorie restriction in mesenchymal stem cells. In Vitro Cell Dev Biol Anim. 2012 Mar;48(3):186-95.
72 Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
73 Paraoxon-induced protein expression changes to SH-SY5Y cells. Chem Res Toxicol. 2010 Nov 15;23(11):1656-62. doi: 10.1021/tx100192f. Epub 2010 Oct 8.
74 A proteomic analysis of acute leukemia cells treated with 9-hydroxyoctadecadienoic acid. Lipids Health Dis. 2016 Nov 10;15(1):192. doi: 10.1186/s12944-016-0359-4.
75 The effects of indirubin-3'-monoxime, a novel AHR ligand, on stress and toxicity-related gene/protein expression in human U937 cells undergoing differentiation and activation. J Immunotoxicol. 2006 Jan 1;3(1):1-10.
76 Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.
77 Site-specific protein adducts of 4-hydroxy-2(E)-nonenal in human THP-1 monocytic cells: protein carbonylation is diminished by ascorbic acid. Chem Res Toxicol. 2010 Jan;23(1):37-47. doi: 10.1021/tx9002462.