Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2EIXAI)

DOT Name Pregnancy-specific beta-1-glycoprotein 2 (PSG2)
Synonyms PS-beta-G-2; PSBG-2; Pregnancy-specific glycoprotein 2; Pregnancy-specific beta-1 glycoprotein E; PS-beta-E
Gene Name PSG2
Related Disease
Acute lymphocytic leukaemia ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Medullary thyroid gland carcinoma ( )
Adult glioblastoma ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Breast fibrocystic disease ( )
Breast neoplasm ( )
Carcinoma of esophagus ( )
Cervical cancer ( )
Cervical carcinoma ( )
Cholangiocarcinoma ( )
Colon carcinoma ( )
Colonic neoplasm ( )
Esophageal cancer ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Hepatocellular carcinoma ( )
Liver cancer ( )
Lung neoplasm ( )
Lung squamous cell carcinoma ( )
Melanoma ( )
Mesothelioma ( )
Myocardial infarction ( )
Neoplasm of esophagus ( )
Ovarian neoplasm ( )
Polyp ( )
Prostate cancer ( )
Prostate carcinoma ( )
Rectal carcinoma ( )
Renal cell carcinoma ( )
Retinoblastoma ( )
Small-cell lung cancer ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Carcinoma ( )
Congenital contractural arachnodactyly ( )
Intrahepatic cholangiocarcinoma ( )
Pancreatic cancer ( )
Adenocarcinoma ( )
Esophageal squamous cell carcinoma ( )
Multiple sclerosis ( )
Non-insulin dependent diabetes ( )
UniProt ID
PSG2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13895 ; PF13927 ; PF07686
Sequence
MGPLSAPPCTEHIKWKGLLVTASLLNFWNLPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQ
NLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETAYSNASLLIQNVTREDAGSY
TLHIIKRGDGTRGVTGYFTFTLYLETPKPSISSSNLNPREAMETVILTCDPETPDTSYQW
WMNGQSLPMTHRFQLSETNRTLFLFGVTKYTAGPYECEIRNSGSASRSDPVTLNLLHGPD
LPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKFQQSGQNLFIPQITTKHSGLYV
CSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPT
Reactome Pathway
Cell surface interactions at the vascular wall (R-HSA-202733 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute lymphocytic leukaemia DISPX75S Definitive Biomarker [1]
Lung adenocarcinoma DISD51WR Definitive Biomarker [2]
Lung cancer DISCM4YA Definitive Altered Expression [3]
Medullary thyroid gland carcinoma DISHBL3K Definitive Biomarker [4]
Adult glioblastoma DISVP4LU Strong Biomarker [5]
Bladder cancer DISUHNM0 Strong Altered Expression [6]
Breast cancer DIS7DPX1 Strong Biomarker [7]
Breast carcinoma DIS2UE88 Strong Biomarker [7]
Breast fibrocystic disease DISUM7ID Strong Biomarker [7]
Breast neoplasm DISNGJLM Strong Biomarker [8]
Carcinoma of esophagus DISS6G4D Strong Altered Expression [9]
Cervical cancer DISFSHPF Strong Altered Expression [10]
Cervical carcinoma DIST4S00 Strong Altered Expression [10]
Cholangiocarcinoma DIS71F6X Strong Altered Expression [11]
Colon carcinoma DISJYKUO Strong Altered Expression [12]
Colonic neoplasm DISSZ04P Strong Biomarker [13]
Esophageal cancer DISGB2VN Strong Altered Expression [9]
Gastric cancer DISXGOUK Strong Biomarker [14]
Glioblastoma multiforme DISK8246 Strong Biomarker [5]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [15]
Liver cancer DISDE4BI Strong Altered Expression [16]
Lung neoplasm DISVARNB Strong Biomarker [17]
Lung squamous cell carcinoma DISXPIBD Strong Altered Expression [18]
Melanoma DIS1RRCY Strong Biomarker [5]
Mesothelioma DISKWK9M Strong Altered Expression [19]
Myocardial infarction DIS655KI Strong Genetic Variation [20]
Neoplasm of esophagus DISOLKAQ Strong Altered Expression [9]
Ovarian neoplasm DISEAFTY Strong Biomarker [21]
Polyp DISRSLYF Strong Altered Expression [22]
Prostate cancer DISF190Y Strong Biomarker [23]
Prostate carcinoma DISMJPLE Strong Biomarker [23]
Rectal carcinoma DIS8FRR7 Strong Biomarker [24]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [25]
Retinoblastoma DISVPNPB Strong Biomarker [26]
Small-cell lung cancer DISK3LZD Strong Biomarker [27]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [28]
Stomach cancer DISKIJSX Strong Biomarker [14]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [6]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [6]
Carcinoma DISH9F1N moderate Biomarker [29]
Congenital contractural arachnodactyly DISOM1K7 moderate Biomarker [30]
Intrahepatic cholangiocarcinoma DIS6GOC8 moderate Biomarker [31]
Pancreatic cancer DISJC981 Disputed Biomarker [32]
Adenocarcinoma DIS3IHTY Limited Biomarker [27]
Esophageal squamous cell carcinoma DIS5N2GV Limited Biomarker [33]
Multiple sclerosis DISB2WZI Limited Biomarker [34]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Pregnancy-specific beta-1-glycoprotein 2 (PSG2). [36]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Pregnancy-specific beta-1-glycoprotein 2 (PSG2). [37]
------------------------------------------------------------------------------------

References

1 A distinguished cancer-screening package containing a DNA sensor and an aptasensor for early and certain detection of acute lymphoblastic leukemia.Clin Chim Acta. 2019 Oct;497:41-47. doi: 10.1016/j.cca.2019.07.009. Epub 2019 Jul 8.
2 Expression of LDH and CEA in serum in the process of targeted therapy of lung adenocarcinoma and the association between them and prognosis.Oncol Lett. 2019 May;17(5):4550-4556. doi: 10.3892/ol.2019.10115. Epub 2019 Mar 5.
3 Association of neurologic manifestations and CEA levels with the diagnosis of brain metastases in lung cancer patients.Clin Transl Oncol. 2019 Nov;21(11):1538-1542. doi: 10.1007/s12094-019-02086-y. Epub 2019 Mar 22.
4 Medullary thyroid carcinoma with double negative calcitonin and CEA: a case report and update of literature review.BMC Endocr Disord. 2019 Oct 16;19(1):103. doi: 10.1186/s12902-019-0435-7.
5 CEA-negative glioblastoma and melanoma cells are sensitive to cytosine deaminase/5-fluorocytosine therapy directed by the carcinoembryonic antigen promoter.Acta Biochim Pol. 2004;51(3):723-32.
6 Influence of spatial configuration on the expression of carcinoembryonic antigen and mucin antigens in human bladder cancer.Int J Cancer. 1997 Jun 11;71(6):986-92. doi: 10.1002/(sici)1097-0215(19970611)71:6<986::aid-ijc14>3.0.co;2-4.
7 The association of five preoperative serum tumor markers and pathological features in patients with breast cancer.J Clin Lab Anal. 2019 Jun;33(5):e22875. doi: 10.1002/jcla.22875. Epub 2019 Mar 6.
8 Combining mammaglobin and carcinoembryonic mRNA markers for early detection of micrometastases from breast cancers--a molecular study of 59 patients.Asian Pac J Cancer Prev. 2006 Jul-Sep;7(3):396-8.
9 The Significance of SCC and CEA mRNA in the Pleural Cavity After Lymphadenectomy in Esophageal Cancer Patients who Underwent Preoperative Treatment.World J Surg. 2018 Mar;42(3):749-757. doi: 10.1007/s00268-017-4203-4.
10 Krppel-Like Factor 10 participates in cervical cancer immunoediting through transcriptional regulation of Pregnancy-Specific Beta-1 Glycoproteins.Sci Rep. 2018 Jun 21;8(1):9445. doi: 10.1038/s41598-018-27711-8.
11 Clinical Significance of Preoperative Serum CEA, CA125, and CA19-9 Levels in Predicting the Resectability of Cholangiocarcinoma.Dis Markers. 2019 Feb 4;2019:6016931. doi: 10.1155/2019/6016931. eCollection 2019.
12 Preoperative neutrophil-lymphocyte ratio and CEA is associated with poor prognosis in patients with synchronous colorectal cancer liver metastasis.Ann Surg Treat Res. 2019 Apr;96(4):191-200. doi: 10.4174/astr.2019.96.4.191. Epub 2019 Mar 28.
13 Mechanisms involved in IL-15 superagonist enhancement of anti-PD-L1 therapy.J Immunother Cancer. 2019 Mar 21;7(1):82. doi: 10.1186/s40425-019-0551-y.
14 Prognostic Biomarkers for Gastric Cancer: An Umbrella Review of the Evidence.Front Oncol. 2019 Nov 29;9:1321. doi: 10.3389/fonc.2019.01321. eCollection 2019.
15 Serum Biomarkers AFP, CEA and CA19-9 Combined Detection for Early Diagnosis of Hepatocellular Carcinoma.Iran J Public Health. 2019 Feb;48(2):314-322.
16 Persistent elevation of carcinoembryonic antigen as first presentation of a medullary thyroid carcinoma.BMJ Case Rep. 2018 Jun 11;2018:bcr2017223233. doi: 10.1136/bcr-2017-223233.
17 Potent control of tumor growth by CEA/CD3-bispecific single-chain antibody constructs that are not competitively inhibited by soluble CEA.J Immunother. 2009 May;32(4):341-52. doi: 10.1097/CJI.0b013e31819b7c70.
18 Assessment of Seven Clinical Tumor Markers in Diagnosis of Non-Small-Cell Lung Cancer.Dis Markers. 2018 Dec 11;2018:9845123. doi: 10.1155/2018/9845123. eCollection 2018.
19 Are oestrogens and genetic predisposition etiologic factors in the development of clear cell carcinoma of the peritoneum?.Med Hypotheses. 2013 Feb;80(2):167-71. doi: 10.1016/j.mehy.2012.11.021. Epub 2012 Dec 21.
20 Clinical and surrogate endpoints in future studies on outcome of carotid revascularization.J Cardiovasc Surg (Torino). 2019 Jun;60(3):325-331. doi: 10.23736/S0021-9509.19.10910-X. Epub 2019 Mar 1.
21 Role of CA125/CEA ratio and ultrasound parameters in identifying metastases to the ovaries in patients with multilocular and multilocular-solid ovarian masses.Ultrasound Obstet Gynecol. 2019 Jan;53(1):116-123. doi: 10.1002/uog.19174.
22 Correlation between Colon Polyps and Metabolic Syndrome and HP Infection Status.Gastroenterol Res Pract. 2019 Jun 4;2019:3916154. doi: 10.1155/2019/3916154. eCollection 2019.
23 Predictive value of the UICC and AJCC 8th edition tumor-nodes-metastasis (TNM) classification for patients treated with radical prostatectomy.Cancer Epidemiol. 2018 Oct;56:126-132. doi: 10.1016/j.canep.2018.08.007. Epub 2018 Aug 31.
24 Ultrasound/CT combined with serum CEA/CA19.9 in the diagnosis and prognosis of rectal cancer.J BUON. 2018 May-Jun;23(3):592-597.
25 Protein gene product 9.5 is diagnostically helpful in delineating high-grade renal cell cancer involving the renal medullary/sinus region from invasive urothelial cell carcinoma of the renal pelvis.Hum Pathol. 2013 May;44(5):712-7. doi: 10.1016/j.humpath.2012.07.024. Epub 2012 Nov 14.
26 Expression of oncogene products, anti-oncogene products and oncofetal antigens in intraductal papillary-mucinous neoplasm of the pancreas.Histopathology. 1996 Oct;29(4):355-61. doi: 10.1111/j.1365-2559.1996.tb01419.x.
27 The role of CEA, CYFRA21-1 and NSE in monitoring tumor response to Nivolumab in advanced non-small cell lung cancer (NSCLC) patients.J Transl Med. 2019 Mar 8;17(1):74. doi: 10.1186/s12967-019-1828-0.
28 CT spectral parameters and serum tumour markers to differentiate histological types of cancer histology.Clin Radiol. 2018 Dec;73(12):1033-1040. doi: 10.1016/j.crad.2018.07.104. Epub 2018 Aug 14.
29 Use of cholesterol and soluble tumour markers CEA and syndecan-2 in pleural effusions in cases of inconclusive cytology.J Clin Pathol. 2019 Aug;72(8):529-535. doi: 10.1136/jclinpath-2018-205650. Epub 2019 Apr 26.
30 Surveillance of primary sclerosing cholangitis with ERC and brush cytology: risk factors for cholangiocarcinoma.Scand J Gastroenterol. 2017 Feb;52(2):242-249. doi: 10.1080/00365521.2016.1250281. Epub 2016 Nov 3.
31 Response Evaluation Criteria in Cancer of the Liver version5 (RECICL 2019 revised version).Hepatol Res. 2019 Sep;49(9):981-989. doi: 10.1111/hepr.13394. Epub 2019 Jul 25.
32 Verification of the effectiveness of fucosylated haptoglobin as a pancreatic cancer marker in clinical diagnosis.Pancreatology. 2019 Jun;19(4):569-577. doi: 10.1016/j.pan.2019.04.007. Epub 2019 Apr 22.
33 Clinical use of tumor biomarkers in prediction for prognosis and chemotherapeutic effect in esophageal squamous cell carcinoma.BMC Cancer. 2019 May 31;19(1):526. doi: 10.1186/s12885-019-5755-5.
34 Sequence variation in the transforming growth factor-beta1 (TGFB1) gene and multiple sclerosis susceptibility.J Neuroimmunol. 2001 May 1;116(1):116-24. doi: 10.1016/s0165-5728(01)00283-1.
35 The serum levels of tumor marker CA19-9, CEA, CA72-4, and NSE in type 2 diabetes without malignancy and the relations to the metabolic control.Saudi Med J. 2017 Feb;38(2):204-208. doi: 10.15537/smj.2017.2.15649.
36 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
37 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.