Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT33HTRR)

DOT Name Chorionic somatomammotropin hormone 1 (CSH1)
Synonyms Choriomammotropin; Lactogen; Placental lactogen; PL
Gene Name CSH1
Related Disease
Bacteremia ( )
Herpes simplex infection ( )
Prostate cancer ( )
Prostate carcinoma ( )
Atrial fibrillation ( )
Breast cancer ( )
Breast carcinoma ( )
Choriocarcinoma ( )
Chromosomal disorder ( )
Cockayne syndrome type 2 ( )
Cowden disease ( )
Craniosynostosis 2 ( )
Dilated cardiomyopathy 1A ( )
Germ cell tumor ( )
Head-neck squamous cell carcinoma ( )
Huntington disease ( )
Lung cancer ( )
Lung carcinoma ( )
Myocardial infarction ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Pituitary gland disorder ( )
Premature aging syndrome ( )
Seminoma ( )
Silver-Russell syndrome ( )
Skin cancer ( )
Testicular germ cell tumor ( )
Type-1/2 diabetes ( )
UV-sensitive syndrome ( )
Adrenoleukodystrophy ( )
Advanced cancer ( )
Methicillin-resistant staphylococci infection ( )
Carcinoma ( )
Cockayne syndrome type 1 ( )
Cytomegalovirus infection ( )
Fetal growth restriction ( )
Intellectual disability ( )
Leukodystrophy ( )
Malaria ( )
Metastatic malignant neoplasm ( )
Myeloproliferative neoplasm ( )
Nephropathy ( )
Nervous system disease ( )
Neuroblastoma ( )
Pituitary tumor ( )
UniProt ID
CSH1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1Z7C
Pfam ID
PF00103
Sequence
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Function Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Neuroactive ligand-receptor interaction (hsa04080 )
PI3K-Akt sig.ling pathway (hsa04151 )
JAK-STAT sig.ling pathway (hsa04630 )
Growth hormone synthesis, secretion and action (hsa04935 )
Reactome Pathway
Growth hormone receptor signaling (R-HSA-982772 )
Prolactin receptor signaling (R-HSA-1170546 )

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bacteremia DIS6N9RZ Definitive Genetic Variation [1]
Herpes simplex infection DISL1SAV Definitive Altered Expression [2]
Prostate cancer DISF190Y Definitive Genetic Variation [3]
Prostate carcinoma DISMJPLE Definitive Genetic Variation [3]
Atrial fibrillation DIS15W6U Strong Biomarker [4]
Breast cancer DIS7DPX1 Strong Altered Expression [5]
Breast carcinoma DIS2UE88 Strong Altered Expression [5]
Choriocarcinoma DISDBVNL Strong Posttranslational Modification [6]
Chromosomal disorder DISM5BB5 Strong Biomarker [7]
Cockayne syndrome type 2 DIS3X0GQ Strong Biomarker [8]
Cowden disease DISMYKCE Strong Biomarker [9]
Craniosynostosis 2 DISBJX9D Strong Biomarker [8]
Dilated cardiomyopathy 1A DIS0RK9Z Strong Biomarker [10]
Germ cell tumor DIS62070 Strong Biomarker [11]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [12]
Huntington disease DISQPLA4 Strong Biomarker [13]
Lung cancer DISCM4YA Strong Genetic Variation [14]
Lung carcinoma DISTR26C Strong Genetic Variation [14]
Myocardial infarction DIS655KI Strong Biomarker [15]
Neoplasm DISZKGEW Strong Biomarker [16]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [17]
Pituitary gland disorder DIS7XB48 Strong Biomarker [18]
Premature aging syndrome DIS51AGT Strong Genetic Variation [19]
Seminoma DIS3J8LJ Strong Biomarker [20]
Silver-Russell syndrome DISSVJ1D Strong Biomarker [21]
Skin cancer DISTM18U Strong Biomarker [22]
Testicular germ cell tumor DIS5RN24 Strong Genetic Variation [11]
Type-1/2 diabetes DISIUHAP Strong Biomarker [23]
UV-sensitive syndrome DISHCN4B Strong Genetic Variation [24]
Adrenoleukodystrophy DISTUD1F moderate Biomarker [25]
Advanced cancer DISAT1Z9 moderate Altered Expression [26]
Methicillin-resistant staphylococci infection DIS6DRDZ moderate Biomarker [27]
Carcinoma DISH9F1N Limited Biomarker [5]
Cockayne syndrome type 1 DIS9JFVY Limited Biomarker [28]
Cytomegalovirus infection DISCEMGC Limited Biomarker [29]
Fetal growth restriction DIS5WEJ5 Limited Biomarker [29]
Intellectual disability DISMBNXP Limited Biomarker [30]
Leukodystrophy DISVY1TT Limited Genetic Variation [30]
Malaria DISQ9Y50 Limited Genetic Variation [31]
Metastatic malignant neoplasm DIS86UK6 Limited Biomarker [32]
Myeloproliferative neoplasm DIS5KAPA Limited Biomarker [33]
Nephropathy DISXWP4P Limited Biomarker [34]
Nervous system disease DISJ7GGT Limited Genetic Variation [35]
Neuroblastoma DISVZBI4 Limited Biomarker [36]
Pituitary tumor DISN67JD Limited Altered Expression [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Chorionic somatomammotropin hormone 1 (CSH1). [38]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Chorionic somatomammotropin hormone 1 (CSH1). [39]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Chorionic somatomammotropin hormone 1 (CSH1). [40]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Chorionic somatomammotropin hormone 1 (CSH1). [41]
Ethanol DMDRQZU Approved Ethanol decreases the expression of Chorionic somatomammotropin hormone 1 (CSH1). [42]
SB-431542 DM0YOXQ Preclinical SB-431542 increases the expression of Chorionic somatomammotropin hormone 1 (CSH1). [43]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Chorionic somatomammotropin hormone 1 (CSH1). [44]
Forskolin DM6ITNG Investigative Forskolin decreases the expression of Chorionic somatomammotropin hormone 1 (CSH1). [45]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Potential synergy activity of the novel ceragenin, CSA-13, against carbapenem-resistant Acinetobacter baumannii strains isolated from bacteremia patients.Biomed Res Int. 2014;2014:710273. doi: 10.1155/2014/710273. Epub 2014 Mar 24.
2 Contributions of nucleotide excision repair, DNA polymerase eta, and homologous recombination to replication of UV-irradiated herpes simplex virus type 1.J Biol Chem. 2010 Apr 30;285(18):13761-8. doi: 10.1074/jbc.M110.107920. Epub 2010 Mar 9.
3 Polymorphisms of DNA repair-related genes with susceptibility and prognosis of prostate cancer.Genet Mol Res. 2014 Jan 24;13(2):4419-24. doi: 10.4238/2014.January.24.20.
4 Central Sleep Apnea with Cheyne-Stokes Breathing in Heart Failure - From Research to Clinical Practice and Beyond.Adv Exp Med Biol. 2018;1067:327-351. doi: 10.1007/5584_2018_146.
5 Placental lactogen is expressed but is not translated into protein in breast cancer.PLoS One. 2014 Jan 24;9(1):e87325. doi: 10.1371/journal.pone.0087325. eCollection 2014.
6 Puralpha, a single-stranded deoxyribonucleic acid binding protein, augments placental lactogen gene transcription.Mol Endocrinol. 2004 Feb;18(2):447-57. doi: 10.1210/me.2003-0392. Epub 2003 Nov 26.
7 Genetic variation associated with chromosomal aberration frequency: A genome-wide association study.Environ Mol Mutagen. 2019 Jan;60(1):17-28. doi: 10.1002/em.22236. Epub 2018 Oct 3.
8 Two Novel Heterozygous Mutations in ERCC8 Cause Cockayne Syndrome in a Chinese Patient.Pediatr Neurol. 2015 Sep;53(3):262-5. doi: 10.1016/j.pediatrneurol.2015.06.006. Epub 2015 Jun 14.
9 Mechanistic Interplay between Light Switching and Guest Binding in Photochromic [Pd(2)Dithienylethene(4)] Coordination Cages.J Am Chem Soc. 2019 Feb 6;141(5):2097-2103. doi: 10.1021/jacs.8b11872. Epub 2019 Jan 22.
10 Association between polymorphisms of the HSPB7 gene and Cheyne-Stokes respiration with central sleep apnea in patients with dilated cardiomyopathy and congestive heart failure.Int J Cardiol. 2016 Oct 15;221:926-31. doi: 10.1016/j.ijcard.2016.07.107. Epub 2016 Jul 9.
11 Economy of Standards: European Association of Urology Guideline Changes Influence Treatment Costs in Stage I Testicular Cancer Patients.Urol Int. 2018;100(3):279-287. doi: 10.1159/000486343. Epub 2018 Mar 7.
12 Expression of nucleotide excision repair genes and the risk for squamous cell carcinoma of the head and neck.Cancer. 2002 Jan 15;94(2):393-7. doi: 10.1002/cncr.10231.
13 Cockayne syndrome B protein antagonizes OGG1 in modulating CAG repeat length in vivo.Aging (Albany NY). 2011 May;3(5):509-14. doi: 10.18632/aging.100324.
14 ERCC6/CSB gene polymorphisms and lung cancer risk.Cancer Lett. 2009 Jan 8;273(1):172-6. doi: 10.1016/j.canlet.2008.08.002. Epub 2008 Sep 11.
15 Xin-Ji-Er-Kang Alleviates Myocardial Infarction-Induced Cardiovascular Remodeling in Rats by Inhibiting Endothelial Dysfunction.Biomed Res Int. 2019 Jun 25;2019:4794082. doi: 10.1155/2019/4794082. eCollection 2019.
16 Placental genes and breast cancer: can the offspring's or father's genotypes predict mother's risk?.Epidemiology. 2003 Mar;14(2):251-3. doi: 10.1097/01.EDE.0000050696.19411.C0.
17 Impact of Staging With Positron-emission Tomography (PET) and Comorbidities on Management and Survival of American Veterans With Stage I-III Non-Small Cell Lung Cancer.Am J Clin Oncol. 2018 May;41(5):513-518. doi: 10.1097/COC.0000000000000316.
18 Regulated expression of chimaeric genes containing the 5'-flanking regions of human growth hormone-related genes in transiently transfected rat anterior pituitary tumor cells.Nucleic Acids Res. 1987 Feb 11;15(3):1297-309. doi: 10.1093/nar/15.3.1297.
19 Cockayne syndrome protein A is a transcription factor of RNA polymerase I and stimulates ribosomal biogenesis and growth.Cell Cycle. 2014;13(13):2029-37. doi: 10.4161/cc.29018. Epub 2014 Apr 29.
20 The testis-specific expression pattern of the growth hormone/placental lactogen (GH/PL) gene cluster changes with malignancy.Hum Pathol. 1999 Oct;30(10):1201-6. doi: 10.1016/s0046-8177(99)90038-2.
21 Characterization of genomic variants in CSH1 and GH2, two candidate genes for Silver-Russell syndrome in 17q24-q25.Genet Test. 2003 Fall;7(3):259-63. doi: 10.1089/109065703322537304.
22 Defective transcription-coupled repair in Cockayne syndrome B mice is associated with skin cancer predisposition.Cell. 1997 May 2;89(3):425-35. doi: 10.1016/s0092-8674(00)80223-8.
23 Can ultrasound imaging be used for the diagnosis of carpal tunnel syndrome in diabetic patients? A systemic review and network meta-analysis.J Neurol. 2020 Jul;267(7):1887-1895. doi: 10.1007/s00415-019-09254-8. Epub 2019 Feb 25.
24 Generation of splice switching oligonucleotides targeting the Cockayne syndrome group B gene product in order to change the diseased cell state.Biochem Biophys Res Commun. 2018 Jun 2;500(2):163-169. doi: 10.1016/j.bbrc.2018.04.015. Epub 2018 Apr 9.
25 Predicted structures of two proteins involved in human diseases.Cell Biochem Biophys. 2001;35(1):35-47. doi: 10.1385/CBB:35:1:35.
26 The CSB repair factor is overexpressed in cancer cells, increases apoptotic resistance, and promotes tumor growth.DNA Repair (Amst). 2013 Apr 1;12(4):293-9. doi: 10.1016/j.dnarep.2013.01.008. Epub 2013 Feb 16.
27 CSA-90 Promotes Bone Formation and Mitigates Methicillin-resistant Staphylococcus aureus Infection in a Rat Open Fracture Model.Clin Orthop Relat Res. 2018 Jun;476(6):1311-1323. doi: 10.1097/01.blo.0000533624.79802.e1.
28 Reduction of sleep-disordered breathing following effective percutaneous mitral valve repair with the MitraClip system.Sleep Breath. 2019 Sep;23(3):815-824. doi: 10.1007/s11325-018-1764-x. Epub 2018 Dec 6.
29 Prospective Cohort Study of Congenital Cytomegalovirus Infection during Pregnancy with Fetal Growth Restriction: Serologic Analysis and Placental Pathology.J Pediatr. 2019 Mar;206:42-48.e2. doi: 10.1016/j.jpeds.2018.10.003. Epub 2018 Nov 6.
30 A possible cranio-oro-facial phenotype in Cockayne syndrome.Orphanet J Rare Dis. 2013 Jan 14;8:9. doi: 10.1186/1750-1172-8-9.
31 Antibodies that inhibit binding of Plasmodium falciparum-infected erythrocytes to chondroitin sulfate A and to the C terminus of merozoite surface protein 1 correlate with reduced placental malaria in Cameroonian women.Infect Immun. 2004 Mar;72(3):1603-7. doi: 10.1128/IAI.72.3.1603-1607.2004.
32 Breast carcinoma in pregnancy with spheroid-like placental metastases-a case report.APMIS. 2018 May;126(5):448-452. doi: 10.1111/apm.12827. Epub 2018 Apr 17.
33 Proto-oncogene c-mpl is involved in spontaneous megakaryocytopoiesis in myeloproliferative disorders.Br J Haematol. 1996 Jan;92(1):60-6. doi: 10.1046/j.1365-2141.1996.00297.x.
34 Risk factors of cardiac surgery-associated acute kidney injury: development and validation of a perioperative predictive nomogram.J Nephrol. 2019 Dec;32(6):937-945. doi: 10.1007/s40620-019-00624-z. Epub 2019 Jun 26.
35 Multisystem analyses of two Cockayne syndrome associated proteins CSA and CSB reveal shared and unique functions.DNA Repair (Amst). 2019 Nov;83:102696. doi: 10.1016/j.dnarep.2019.102696. Epub 2019 Sep 12.
36 Cockayne syndrome group A and B proteins converge on transcription-linked resolution of non-B DNA.Proc Natl Acad Sci U S A. 2016 Nov 1;113(44):12502-12507. doi: 10.1073/pnas.1610198113. Epub 2016 Oct 18.
37 Differential binding of rat pituitary-specific nuclear factors to the 5'-flanking region of pituitary and placental members of the human growth hormone gene family.Mol Cell Biochem. 1991 Aug 14;106(2):181-7. doi: 10.1007/BF00230184.
38 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
39 High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.
40 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
41 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
42 Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
43 Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
44 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
45 Effects of selective serotonin-reuptake inhibitors (SSRIs) on human villous trophoblasts syncytialization. Toxicol Appl Pharmacol. 2018 Jun 15;349:8-20. doi: 10.1016/j.taap.2018.04.018. Epub 2018 Apr 19.