Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4ZTPTM)

• DOT Name: Ribosome-binding protein 1 (RRBP1)
• Synonyms: 180 kDa ribosome receptor homolog; RRp; ES/130-related protein; Ribosome receptor protein
• Gene Name: RRBP1
• Related Disease:
  Adult lymphoma
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Lymphoma
  Pediatric lymphoma
  Precancerous condition
  Advanced cancer
  Carcinoma
  Carcinoma of esophagus
  Colorectal carcinoma
  Endometrial carcinoma
  Epithelial ovarian cancer
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Malignant soft tissue neoplasm
  Neoplasm
  Pneumonia
  Pneumonitis
  Prostate cancer
  Prostate carcinoma
  Respiratory papillomatosis
  Sarcoma
  Sezary syndrome
  Skin carcinoma
  T-cell lymphoma
  Coronary heart disease
  Hypereosinophilic syndrome
  Idiopathic hypereosinophilic syndrome
  Ankylosing spondylitis
  Asthma
  Human papillomavirus infection
  Myeloproliferative neoplasm
  Neuroblastoma
  Schistosomiasis
  Temporal lobe epilepsy
• UniProt ID: RRBP1_HUMAN
• Pfam ID: PF05104
• Sequence:
  MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKK
  KKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAP
  VATVPAMPQEKLASSPKDKKKKEKKVAKVEPAVSSVVNSIQVLTSKAAILETAPKEVPMV
  VVPPVGAKGNTPATGTTQGKKAEGTQNQSKKAEGAPNQGRKAEGTPNQGKKTEGTPNQGK
  KAEGTPNQGKKAEGTPNQGKKAEGAQNQGKKVDTTPNQGKKVEGAPTQGRKAEGAQNQAK
  KVEGAQNQGKKAEGAQNQGKKGEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGK
  KAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKVEGAQNQGKKAEGAQNQGKKAEGAQNQGK
  KAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKVEGAQNQGK
  KAEGAQNQGKKAEGAQNQGKKAEGAQNQGQKGEGAQNQGKKTEGAQGKKAERSPNQGKKG
  EGAPIQGKKADSVANQGTKVEGITNQGKKAEGSPSEGKKAEGSPNQGKKADAAANQGKKT
  ESASVQGRNTDVAQSPEAPKQEAPAKKKSGSKKKGEPGPPDADGPLYLPYKTLVSTVGSM
  VFNEGEAQRLIEILSEKAGIIQDTWHKATQKGDPVAILKRQLEEKEKLLATEQEDAAVAK
  SKLRELNKEMAAEKAKAAAGEAKVKKQLVAREQEITAVQARMQASYREHVKEVQQLQGKI
  RTLQEQLENGPNTQLARLQQENSILRDALNQATSQVESKQNAELAKLRQELSKVSKELVE
  KSEAVRQDEQQRKALEAKAAAFEKQVLQLQASHRESEEALQKRLDEVSRELCHTQSSHAS
  LRADAEKAQEQQQQMAELHSKLQSSEAEVRSKCEELSGLHGQLQEARAENSQLTERIRSI
  EALLEAGQARDAQDVQASQAEADQQQTRLKELESQVSGLEKEAIELREAVEQQKVKNNDL
  REKNWKAMEALATAEQACKEKLLSLTQAKEESEKQLCLIEAQTMEALLALLPELSVLAQQ
  NYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEG
  MLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEIVEKLKGELESSDQVREHTSH
  LEAELEKHMAAASAECQNYAKEVAGLRQLLLESQSQLDAAKSEAQKQSDELALVRQQLSE
  MKSHVEDGDIAGAPASSPEAPPAEQDPVQLKTQLEWTEAILEDEQTQRQKLTAEFEEAQT
  SACRLQEELEKLRTAGPLESSETEEASQLKERLEKEKKLTSDLGRAATRLQELLKTTQEQ
  LAREKDTVKKLQEQLEKAEDGSSSKEGTSV
• Function: Acts as a ribosome receptor and mediates interaction between the ribosome and the endoplasmic reticulum membrane.
• KEGG Pathway: Protein processing in endoplasmic reticulum (hsa04141)
• Reactome Pathway: Signaling by ALK fusions and activated point mutants (R-HSA-9725370)

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult lymphoma	DISK8IZR	Definitive	Biomarker	[1]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Definitive	Biomarker	[2]
Liver cancer	DISDE4BI	Definitive	Biomarker	[2]
Lymphoma	DISN6V4S	Definitive	Biomarker	[1]
Pediatric lymphoma	DIS51BK2	Definitive	Biomarker	[1]
Precancerous condition	DISV06FL	Definitive	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Carcinoma	DISH9F1N	Strong	Altered Expression	[4]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[4]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[4]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[3]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[7]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Genetic Variation	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Pneumonia	DIS8EF3M	Strong	Biomarker	[10]
Pneumonitis	DIS88E0K	Strong	Biomarker	[10]
Prostate cancer	DISF190Y	Strong	Biomarker	[11]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[11]
Respiratory papillomatosis	DISXL96I	Strong	Biomarker	[12]
Sarcoma	DISZDG3U	Strong	Genetic Variation	[8]
Sezary syndrome	DISFMTC7	Strong	Biomarker	[13]
Skin carcinoma	DISUZREN	Strong	Genetic Variation	[14]
T-cell lymphoma	DISSXRTQ	Strong	Biomarker	[15]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[16]
Hypereosinophilic syndrome	DISVK62S	moderate	Biomarker	[17]
Idiopathic hypereosinophilic syndrome	DISXAPO9	moderate	Biomarker	[17]
Ankylosing spondylitis	DISRC6IR	Limited	Altered Expression	[18]
Asthma	DISW9QNS	Limited	Biomarker	[19]
Human papillomavirus infection	DISX61LX	Limited	Genetic Variation	[20]
Myeloproliferative neoplasm	DIS5KAPA	Limited	Biomarker	[21]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[22]
Schistosomiasis	DIS6PD44	Limited	Biomarker	[23]
Temporal lobe epilepsy	DISNOPXX	Limited	Genetic Variation	[24]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ribosome-binding protein 1 (RRBP1).	[25]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ribosome-binding protein 1 (RRBP1).	[43]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Ribosome-binding protein 1 (RRBP1).	[44]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the phosphorylation of Ribosome-binding protein 1 (RRBP1).	[48]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ribosome-binding protein 1 (RRBP1).	[26]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ribosome-binding protein 1 (RRBP1).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Ribosome-binding protein 1 (RRBP1).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ribosome-binding protein 1 (RRBP1).	[29]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Ribosome-binding protein 1 (RRBP1).	[30]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ribosome-binding protein 1 (RRBP1).	[31]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Ribosome-binding protein 1 (RRBP1).	[32]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Ribosome-binding protein 1 (RRBP1).	[33]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Ribosome-binding protein 1 (RRBP1).	[34]
Marinol	DM70IK5	Approved	Marinol increases the expression of Ribosome-binding protein 1 (RRBP1).	[35]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Ribosome-binding protein 1 (RRBP1).	[36]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Ribosome-binding protein 1 (RRBP1).	[37]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Ribosome-binding protein 1 (RRBP1).	[38]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Ribosome-binding protein 1 (RRBP1).	[39]
Haloperidol	DM96SE0	Approved	Haloperidol decreases the expression of Ribosome-binding protein 1 (RRBP1).	[39]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Ribosome-binding protein 1 (RRBP1).	[40]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Ribosome-binding protein 1 (RRBP1).	[41]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ribosome-binding protein 1 (RRBP1).	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Ribosome-binding protein 1 (RRBP1).	[45]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ribosome-binding protein 1 (RRBP1).	[46]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Ribosome-binding protein 1 (RRBP1).	[47]

References

• [1] Molecular profiling of CD3-CD4+ T cells from patients with the lymphocytic variant of hypereosinophilic syndrome reveals targeting of growth control pathways.Blood. 2009 Oct 1;114(14):2969-83. doi: 10.1182/blood-2008-08-175091. Epub 2009 Jul 16.
• [2] Sorafenib-loaded hydroxyethyl starch-TG100-115 micelles for the treatment of liver cancer based on synergistic treatment.Drug Deliv. 2019 Dec;26(1):756-764. doi: 10.1080/10717544.2019.1642418.
• [3] Expression of RRBP1 in epithelial ovarian cancer and its clinical significance.Biosci Rep. 2019 Jul 23;39(7):BSR20190656. doi: 10.1042/BSR20190656. Print 2019 Jul 31.
• [4] RRBP1 overexpression is associated with progression and prognosis in endometrial endometrioid adenocarcinoma.Diagn Pathol. 2019 Jan 26;14(1):7. doi: 10.1186/s13000-019-0784-6.
• [5] Expression and significance of RRBP1 in esophageal carcinoma.Cancer Manag Res. 2018 May 17;10:1243-1249. doi: 10.2147/CMAR.S158013. eCollection 2018.
• [6] Specific knockdown of uPA/uPAR attenuates invasion in glioblastoma cells and xenografts by inhibition of cleavage and trafficking of Notch -1 receptor.Mol Cancer. 2011 Oct 17;10:130. doi: 10.1186/1476-4598-10-130.
• [7] Aspartyl-asparagyl beta hydroxylase over-expression in human hepatoma is linked to activation of insulin-like growth factor and notch signaling mechanisms.Hepatology. 2006 Aug;44(2):446-57. doi: 10.1002/hep.21272.
• [8] ALK oncoproteins in atypical inflammatory myofibroblastic tumours: novel RRBP1-ALK fusions in epithelioid inflammatory myofibroblastic sarcoma.J Pathol. 2017 Feb;241(3):316-323. doi: 10.1002/path.4836. Epub 2016 Dec 15.
• [9] Effects of goal-directed crystalloid vs. colloid fluid therapy on microcirculation during free flap surgery: A randomised clinical trial.Eur J Anaesthesiol. 2019 Aug;36(8):592-604. doi: 10.1097/EJA.0000000000001024.
• [10] 6% Hydroxyethyl starch (HES 130/0.4) diminishes glycocalyx degradation and decreases vascular permeability during systemic and pulmonary inflammation in mice.Crit Care. 2018 May 1;22(1):111. doi: 10.1186/s13054-017-1846-3.
• [11] Predictive factors for prolonged hospital stay after retropubic radical prostatectomy in a high-volume teaching center.Int Braz J Urol. 2018 Nov-Dec;44(6):1089-1105. doi: 10.1590/S1677-5538.IBJU.2017.0339.
• [12] Model of human recurrent respiratory papilloma on chicken embryo chorioallantoic membrane for tumor angiogenesis research.Histol Histopathol. 2017 Jul;32(7):699-710. doi: 10.14670/HH-11-831. Epub 2016 Oct 10.
• [13] Transcriptome analysis of Szary syndrome and lymphocytic-variant hypereosinophilic syndrome T cells reveals common and divergent genes.Oncotarget. 2019 Aug 20;10(49):5052-5069. doi: 10.18632/oncotarget.27120. eCollection 2019 Aug 20.
• [14] Cancer recording in patients with and without type 2 diabetes in the Clinical Practice Research Datalink primary care data and linked hospital admission data: a cohort study.BMJ Open. 2018 May 26;8(5):e020827. doi: 10.1136/bmjopen-2017-020827.
• [15] The lymphoid variant of hypereosinophilic syndrome: study of 21 patients with CD3-CD4+ aberrant T-cell phenotype.Medicine (Baltimore). 2014 Oct;93(17):255-266. doi: 10.1097/MD.0000000000000088.
• [16] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [17] PDGFRalpha/FIP1L1-positive chronic eosinophilic leukemia presenting with retro-orbital localization: efficacy of imatinib treatment.Cancer Chemother Pharmacol. 2008 Apr;61(4):713-6. doi: 10.1007/s00280-007-0507-7. Epub 2007 Jun 5.
• [18] Involvement of Notch1/Hes signaling pathway in ankylosing spondylitis.Int J Clin Exp Pathol. 2015 Mar 1;8(3):2737-45. eCollection 2015.
• [19] Long-term impact of giving antibiotics before skin incision versus after cord clamping on children born by caesarean section: protocol for a longitudinal study based on UK electronic health records.BMJ Open. 2019 Sep 26;9(9):e033013. doi: 10.1136/bmjopen-2019-033013.
• [20] HPV genotyping and HLA II analysis in a pedigree study of pediatric RRP: preliminary results.Int J Pediatr Otorhinolaryngol. 2006 Nov;70(11):1935-9. doi: 10.1016/j.ijporl.2006.07.003. Epub 2006 Aug 21.
• [21] The 2008 World Health Organization classification system for myeloproliferative neoplasms: order out of chaos.Cancer. 2009 Sep 1;115(17):3842-7. doi: 10.1002/cncr.24440.
• [22] Notch pathway activation induces neuroblastoma tumor cell growth arrest.Pediatr Blood Cancer. 2012 May;58(5):682-9. doi: 10.1002/pbc.23202. Epub 2011 Jul 8.
• [23] Analysis of risk factors and changing trends the infection rate of intestinal schistosomiasis caused by S. japonicum from 2005 to 2014 in Lushan city.Parasitol Int. 2018 Dec;67(6):751-758. doi: 10.1016/j.parint.2018.07.007. Epub 2018 Jul 25.
• [24] Does education play a role in language reorganization after surgery in drug refractory temporal lobe epilepsy: An fMRI based study?.Epilepsy Res. 2017 Oct;136:88-96. doi: 10.1016/j.eplepsyres.2017.07.017. Epub 2017 Jul 29.
• [25] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [26] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [27] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Extremely low copper concentrations affect gene expression profiles of human prostate epithelial cell lines. Chem Biol Interact. 2010 Oct 6;188(1):214-9.
• [30] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [31] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [32] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [33] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [34] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [35] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [36] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [37] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [38] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [39] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [40] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [41] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [42] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [45] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [46] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [47] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [48] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.