Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5B9LXS)

• DOT Name: Sushi repeat-containing protein SRPX (SRPX)
• Gene Name: SRPX
• Related Disease:
  Hepatocellular carcinoma
  Adenocarcinoma
  Advanced cancer
  Aural atresia, congenital
  Colorectal neoplasm
  Delirium
  Dementia
  Depression
  Epithelial ovarian cancer
  Mental disorder
  Ovarian cancer
  Ovarian neoplasm
  Prostate cancer
  Prostate carcinoma
  Sleep disorder
  Neuroendocrine neoplasm
  Small-cell lung cancer
  Neoplasm
  Tuberculosis
  Anxiety
  Anxiety disorder
  Common variable immunodeficiency
  Congenital heart disease
  Glaucoma/ocular hypertension
  Pachyonychia congenita 3
  Post-traumatic stress disorder
• UniProt ID: SRPX_HUMAN
• Pfam ID: PF13778 ; PF02494 ; PF00084
• Sequence:
  MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPI
  KVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRC
  PTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPP
  RIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYT
  VYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSP
  ARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLG
  MLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVD
  KHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT
• Function: May be involved in phagocytosis during disk shedding, cell adhesion to cells other than the pigment epithelium or signal transduction.
• Tissue Specificity: Detected in fibroblasts (at protein level) . Retina and heart; less in placenta, pancreas, lung, liver, skeletal muscle, kidney and brain.

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Aural atresia, congenital	DISCP7UV	Strong	Biomarker	[4]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[5]
Delirium	DIS2OKP1	Strong	Genetic Variation	[6]
Dementia	DISXL1WY	Strong	Genetic Variation	[7]
Depression	DIS3XJ69	Strong	Biomarker	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[3]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[9]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[3]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[3]
Prostate cancer	DISF190Y	Strong	Altered Expression	[10]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[10]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[11]
Neuroendocrine neoplasm	DISNPLOO	moderate	Altered Expression	[12]
Small-cell lung cancer	DISK3LZD	moderate	Altered Expression	[12]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[10]
Tuberculosis	DIS2YIMD	Disputed	Biomarker	[13]
Anxiety	DISIJDBA	Limited	Genetic Variation	[14]
Anxiety disorder	DISBI2BT	Limited	Genetic Variation	[14]
Common variable immunodeficiency	DISHE7JQ	Limited	Genetic Variation	[15]
Congenital heart disease	DISQBA23	Limited	Biomarker	[16]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Altered Expression	[17]
Pachyonychia congenita 3	DISZLC6C	Limited	Biomarker	[18]
Post-traumatic stress disorder	DISHL1EY	Limited	Genetic Variation	[19]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[20]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[21]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[22]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[23]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[24]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[25]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[26]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[27]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[28]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[29]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[30]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Sushi repeat-containing protein SRPX (SRPX).	[31]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Sushi repeat-containing protein SRPX (SRPX).	[32]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[33]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[34]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[35]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[35]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[36]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Sushi repeat-containing protein SRPX (SRPX).	[37]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[38]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[39]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[43]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Sushi repeat-containing protein SRPX (SRPX).	[44]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Sushi repeat-containing protein SRPX (SRPX).	[45]

References

• [1] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [2] Expression of drs mRNA in human lung adenocarcinomas.Hum Pathol. 2002 Jun;33(6):615-9. doi: 10.1053/hupa.2002.125373.
• [3] SRPX and HMCN1 regulate cancerassociated fibroblasts to promote the invasiveness of ovarian carcinoma.Oncol Rep. 2019 Dec;42(6):2706-2715. doi: 10.3892/or.2019.7379. Epub 2019 Oct 17.
• [4] Sushi repeat-containing protein 1: a novel disease-associated molecule in cerebral amyloid angiopathy.Acta Neuropathol. 2017 Oct;134(4):605-617. doi: 10.1007/s00401-017-1720-z. Epub 2017 May 6.
• [5] Down-regulation of drs mRNA in colorectal neoplasms.Jpn J Cancer Res. 2002 Aug;93(8):888-93. doi: 10.1111/j.1349-7006.2002.tb01334.x.
• [6] Accuracy of the Delirium Observational Screening Scale (DOS) as a screening tool for delirium in patients with advanced cancer.BMC Cancer. 2019 Feb 19;19(1):160. doi: 10.1186/s12885-019-5351-8.
• [7] Subsyndromal delirium compared with delirium, dementia, and subjects without delirium or dementia in elderly general hospital admissions and nursing home residents.Alzheimers Dement (Amst). 2016 Dec 1;7:1-10. doi: 10.1016/j.dadm.2016.11.002. eCollection 2017.
• [8] Screening for Executive Dysfunction in Late-Life Depression: Utility of Trail Making Test and Self-Report Measures.Am J Geriatr Psychiatry. 2018 Oct;26(10):1091-1094. doi: 10.1016/j.jagp.2018.06.006. Epub 2018 Jun 25.
• [9] Subsyndromal delirium in the intensive care setting: Phenomenological characteristics and discrimination of subsyndromal delirium versus no and full-syndromal delirium.Palliat Support Care. 2018 Feb;16(1):3-13. doi: 10.1017/S1478951517000104. Epub 2017 Mar 6.
• [10] Exploring targets of TET2-mediated methylation reprogramming as potential discriminators of prostate cancer progression.Clin Epigenetics. 2019 Mar 27;11(1):54. doi: 10.1186/s13148-019-0651-z.
• [11] Sleep-wake cycle disturbances in elderly acute general medical inpatients: Longitudinal relationship to delirium and dementia.Alzheimers Dement (Amst). 2017 Jan 21;7:61-68. doi: 10.1016/j.dadm.2016.12.013. eCollection 2017.
• [12] Downregulation of drs tumor suppressor gene in highly malignant human pulmonary neuroendocrine tumors.Oncol Rep. 2009 Jun;21(6):1367-72. doi: 10.3892/or_00000362.
• [13] Rapid identification of mycobacteria and drug-resistant Mycobacterium tuberculosis by use of a single multiplex PCR and DNA sequencing.J Clin Microbiol. 2012 Feb;50(2):326-36. doi: 10.1128/JCM.05570-11. Epub 2011 Dec 7.
• [14] Interaction of the neuropeptide S receptor gene AsnIle variant and environment: contribution to affective and anxiety disorders, and suicidal behaviour.Int J Neuropsychopharmacol. 2014 Apr;17(4):541-52. doi: 10.1017/S1461145713001478. Epub 2013 Dec 16.
• [15] Genome-wide association identifies diverse causes of common variable immunodeficiency.J Allergy Clin Immunol. 2011 Jun;127(6):1360-7.e6. doi: 10.1016/j.jaci.2011.02.039. Epub 2011 Apr 17.
• [16] Association of aminoacyl-tRNA synthetases gene polymorphisms with the risk of congenital heart disease in the Chinese Han population.PLoS One. 2014 Oct 13;9(10):e110072. doi: 10.1371/journal.pone.0110072. eCollection 2014.
• [17] ETX1 is over-expressed in the glaucomatous trabecular meshwork.Mol Vis. 2009 Oct 16;15:2061-7.
• [18] Studies of the antitumor mechanism of action of dermaseptin B2, a multifunctional cationic antimicrobial peptide, reveal a partial implication of cell surface glycosaminoglycans.PLoS One. 2017 Aug 10;12(8):e0182926. doi: 10.1371/journal.pone.0182926. eCollection 2017.
• [19] Post-traumatic stress disorder (PTSD) related symptoms following an experience of delirium.J Psychosom Res. 2019 Aug;123:109725. doi: 10.1016/j.jpsychores.2019.05.003. Epub 2019 May 24.
• [20] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [21] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [22] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [23] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [24] Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
• [25] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [26] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [27] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [28] Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
• [29] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [30] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [31] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [32] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [33] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [34] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [35] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [36] Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
• [37] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [38] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [39] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [40] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [41] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [42] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [43] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [44] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [45] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.