Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7AG0SW)

• DOT Name: Centromere protein F (CENPF)
• Synonyms: CENP-F; AH antigen; Kinetochore protein CENPF; Mitosin
• Gene Name: CENPF
• Related Disease:
  Esophageal squamous cell carcinoma
  Prostate neoplasm
  Acinar cell carcinoma
  Advanced cancer
  Benign neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Ciliopathy
  Colorectal carcinoma
  Gastric cancer
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Influenza
  Intellectual disability
  Isolated congenital microcephaly
  Myeloproliferative neoplasm
  Seckel syndrome
  Squamous cell carcinoma
  Stomach cancer
  Stromme syndrome
  Meningioma
  Small-cell lung cancer
  Neoplasm
  Neuroblastic tumor
  Prostate cancer
  Prostate carcinoma
• UniProt ID: CENPF_HUMAN
• Pfam ID: PF10490 ; PF10473 ; PF10481
• Sequence:
  MSWALEEWKEGLPTRALQKIQELEGQLDKLKKEKQQRQFQLDSLEAALQKQKQKVENEKT
  EGTNLKRENQRLMEICESLEKTKQKISHELQVKESQVNFQEGQLNSGKKQIEKLEQELKR
  CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKR
  LEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQQEKTPSHLSSNSQRTPIRRD
  FSASYFSGEQEVTPSRSTLQIGKRDANSSFFDNSSSPHLLDQLKAQNQELRNKINELELR
  LQGHEKEMKGQVNKFQELQLQLEKAKVELIEKEKVLNKCRDELVRTTAQYDQASTKYTAL
  EQKLKKLTEDLSCQRQNAESARCSLEQKIKEKEKEFQEELSRQQRSFQTLDQECIQMKAR
  LTQELQQAKNMHNVLQAELDKLTSVKQQLENNLEEFKQKLCRAEQAFQASQIKENELRRS
  MEEMKKENNLLKSHSEQKAREVCHLEAELKNIKQCLNQSQNFAEEMKAKNTSQETMLRDL
  QEKINQQENSLTLEKLKLAVADLEKQRDCSQDLLKKREHHIEQLNDKLSKTEKESKALLS
  ALELKKKEYEELKEEKTLFSCWKSENEKLLTQMESEKENLQSKINHLETCLKTQQIKSHE
  YNERVRTLEMDRENLSVEIRNLHNVLDSKSVEVETQKLAYMELQQKAEFSDQKHQKEIEN
  MCLKTSQLTGQVEDLEHKLQLLSNEIMDKDRCYQDLHAEYESLRDLLKSKDASLVTNEDH
  QRSLLAFDQQPAMHHSFANIIGEQGSMPSERSECRLEADQSPKNSAILQNRVDSLEFSLE
  SQKQMNSDLQKQCEELVQIKGEIEENLMKAEQMHQSFVAETSQRISKLQEDTSAHQNVVA
  ETLSALENKEKELQLLNDKVETEQAEIQELKKSNHLLEDSLKELQLLSETLSLEKKEMSS
  IISLNKREIEELTQENGTLKEINASLNQEKMNLIQKSESFANYIDEREKSISELSDQYKQ
  EKLILLQRCEETGNAYEDLSQKYKAAQEKNSKLECLLNECTSLCENRKNELEQLKEAFAK
  EHQEFLTKLAFAEERNQNLMLELETVQQALRSEMTDNQNNSKSEAGGLKQEIMTLKEEQN
  KMQKEVNDLLQENEQLMKVMKTKHECQNLESEPIRNSVKERESERNQCNFKPQMDLEVKE
  ISLDSYNAQLVQLEAMLRNKELKLQESEKEKECLQHELQTIRGDLETSNLQDMQSQEISG
  LKDCEIDAEEKYISGPHELSTSQNDNAHLQCSLQTTMNKLNELEKICEILQAEKYELVTE
  LNDSRSECITATRKMAEEVGKLLNEVKILNDDSGLLHGELVEDIPGGEFGEQPNEQHPVS
  LAPLDESNSYEHLTLSDKEVQMHFAELQEKFLSLQSEHKILHDQHCQMSSKMSELQTYVD
  SLKAENLVLSTNLRNFQGDLVKEMQLGLEEGLVPSLSSSCVPDSSSLSSLGDSSFYRALL
  EQTGDMSLLSNLEGAVSANQCSVDEVFCSSLQEENLTRKETPSAPAKGVEELESLCEVYR
  QSLEKLEEKMESQGIMKNKEIQELEQLLSSERQELDCLRKQYLSENEQWQQKLTSVTLEM
  ESKLAAEKKQTEQLSLELEVARLQLQGLDLSSRSLLGIDTEDAIQGRNESCDISKEHTSE
  TTERTPKHDVHQICDKDAQQDLNLDIEKITETGAVKPTGECSGEQSPDTNYEPPGEDKTQ
  GSSECISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESL
  LNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQELLQRV
  ETSEGLNSDLEMHADKSSREDIGDNVAKVNDSWKERFLDVENELSRIRSEKASIEHEALY
  LEADLEVVQTEKLCLEKDNENKQKVIVCLEEELSVVTSERNQLRGELDTMSKKTTALDQL
  SEKMKEKTQELESHQSECLHCIQVAEAEVKEKTELLQTLSSDVSELLKDKTHLQEKLQSL
  EKDSQALSLTKCELENQIAQLNKEKELLVKESESLQARLSESDYEKLNVSKALEAALVEK
  GEFALRLSSTQEEVHQLRRGIEKLRVRIEADEKKQLHIAEKLKERERENDSLKDKVENLE
  RELQMSEENQELVILDAENSKAEVETLKTQIEEMARSLKVFELDLVTLRSEKENLTKQIQ
  EKQGQLSELDKLLSSFKSLLEEKEQAEIQIKEESKTAVEMLQNQLKELNEAVAALCGDQE
  IMKATEQSLDPPIEEEHQLRNSIEKLRARLEADEKKQLCVLQQLKESEHHADLLKGRVEN
  LERELEIARTNQEHAALEAENSKGEVETLKAKIEGMTQSLRGLELDVVTIRSEKENLTNE
  LQKEQERISELEIINSSFENILQEKEQEKVQMKEKSSTAMEMLQTQLKELNERVAALHND
  QEACKAKEQNLSSQVECLELEKAQLLQGLDEAKNNYIVLQSSVNGLIQEVEDGKQKLEKK
  DEEISRLKNQIQDQEQLVSKLSQVEGEHQLWKEQNLELRNLTVELEQKIQVLQSKNASLQ
  DTLEVLQSSYKNLENELELTKMDKMSFVEKVNKMTAKETELQREMHEMAQKTAELQEELS
  GEKNRLAGELQLLLEEIKSSKDQLKELTLENSELKKSLDCMHKDQVEKEGKVREEIAEYQ
  LRLHEAEKKHQALLLDTNKQYEVEIQTYREKLTSKEECLSSQKLEIDLLKSSKEELNNSL
  KATTQILEELKKTKMDNLKYVNQLKKENERAQGKMKLLIKSCKQLEEEKEILQKELSQLQ
  AAQEKQKTGTVMDTKVDELTTEIKELKETLEEKTKEADEYLDKYCSLLISHEKLEKAKEM
  LETQVAHLCSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKASGKRQRSSGIWE
  NGRGPTPATPESFSKKSKKAVMSGIHPAEDTEGTEFEPEGLPEVVKKGFADIPTGKTSPY
  ILRRTTMATRTSPRLAAQKLALSPLSLGKENLAESSKPTAGGSRSQKVKVAQRSPVDSGT
  ILREPTTKSVPVNNLPERSPTDSPREGLRVKRGRLVPSPKAGLESNGSENCKVQ
• Function: Required for kinetochore function and chromosome segregation in mitosis. Required for kinetochore localization of dynein, LIS1, NDE1 and NDEL1. Regulates recycling of the plasma membrane by acting as a link between recycling vesicles and the microtubule network though its association with STX4 and SNAP25. Acts as a potential inhibitor of pocket protein-mediated cellular processes during development by regulating the activity of RB proteins during cell division and proliferation. May play a regulatory or permissive role in the normal embryonic cardiomyocyte cell cycle and in promoting continued mitosis in transformed, abnormally dividing neonatal cardiomyocytes. Interaction with RB directs embryonic stem cells toward a cardiac lineage. Involved in the regulation of DNA synthesis and hence cell cycle progression, via its C-terminus. Has a potential role regulating skeletal myogenesis and in cell differentiation in embryogenesis. Involved in dendritic cell regulation of T-cell immunity against chlamydia.
• Reactome Pathway:
  Polo-like kinase mediated events (R-HSA-156711)
  Separation of Sister Chromatids (R-HSA-2467813)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  RHO GTPases Activate Formins (R-HSA-5663220)
  Mitotic Prometaphase (R-HSA-68877)
  EML4 and NUDC in mitotic spindle formation (R-HSA-9648025)
  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal (R-HSA-141444)

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Biomarker	[1]
Prostate neoplasm	DISHDKGQ	Definitive	Biomarker	[2]
Acinar cell carcinoma	DIS37Y0J	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Benign neoplasm	DISDUXAD	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Ciliopathy	DIS10G4I	Strong	Genetic Variation	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[9]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[11]
Influenza	DIS3PNU3	Strong	Biomarker	[12]
Intellectual disability	DISMBNXP	Strong	Genetic Variation	[7]
Isolated congenital microcephaly	DISUXHZ6	Strong	Biomarker	[13]
Myeloproliferative neoplasm	DIS5KAPA	Strong	Biomarker	[13]
Seckel syndrome	DISEVUBA	Strong	Biomarker	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[10]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[9]
Stromme syndrome	DISZV5Z1	Strong	Autosomal recessive	[14]
Meningioma	DISPT4TG	moderate	Biomarker	[15]
Small-cell lung cancer	DISK3LZD	moderate	Biomarker	[16]
Neoplasm	DISZKGEW	Limited	Altered Expression	[9]
Neuroblastic tumor	DISKWPS1	Limited	Altered Expression	[17]
Prostate cancer	DISF190Y	Limited	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[18]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Centromere protein F (CENPF).	[19]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Centromere protein F (CENPF).	[27]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Centromere protein F (CENPF).	[54]

46 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Centromere protein F (CENPF).	[20]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Centromere protein F (CENPF).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Centromere protein F (CENPF).	[22]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Centromere protein F (CENPF).	[23]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Centromere protein F (CENPF).	[24]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Centromere protein F (CENPF).	[25]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Centromere protein F (CENPF).	[26]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Centromere protein F (CENPF).	[28]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Centromere protein F (CENPF).	[29]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Centromere protein F (CENPF).	[30]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Centromere protein F (CENPF).	[31]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Centromere protein F (CENPF).	[30]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Centromere protein F (CENPF).	[32]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Centromere protein F (CENPF).	[33]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Centromere protein F (CENPF).	[34]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Centromere protein F (CENPF).	[35]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Centromere protein F (CENPF).	[36]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Centromere protein F (CENPF).	[37]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Centromere protein F (CENPF).	[29]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Centromere protein F (CENPF).	[38]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Centromere protein F (CENPF).	[39]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Centromere protein F (CENPF).	[40]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Centromere protein F (CENPF).	[41]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Centromere protein F (CENPF).	[42]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Centromere protein F (CENPF).	[43]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Centromere protein F (CENPF).	[44]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Centromere protein F (CENPF).	[45]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Centromere protein F (CENPF).	[46]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Centromere protein F (CENPF).	[47]
Lovastatin	DM9OZWQ	Approved	Lovastatin increases the expression of Centromere protein F (CENPF).	[43]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Centromere protein F (CENPF).	[48]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Centromere protein F (CENPF).	[49]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Centromere protein F (CENPF).	[26]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Centromere protein F (CENPF).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Centromere protein F (CENPF).	[41]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Centromere protein F (CENPF).	[51]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Centromere protein F (CENPF).	[52]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Centromere protein F (CENPF).	[53]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Centromere protein F (CENPF).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Centromere protein F (CENPF).	[56]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Centromere protein F (CENPF).	[57]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Centromere protein F (CENPF).	[58]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Centromere protein F (CENPF).	[59]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Centromere protein F (CENPF).	[60]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of Centromere protein F (CENPF).	[61]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Centromere protein F (CENPF).	[41]

References

• [1] Prognostic relevance and therapeutic implications of centromere protein F expression in patients with esophageal squamous cell carcinoma.Dis Esophagus. 2013 Aug;26(6):636-43. doi: 10.1111/dote.12002. Epub 2012 Nov 16.
• [2] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [3] Correlation of CENP-F gene expression with tumor-proliferating activity in human salivary gland tumors.Oral Oncol. 2005 Aug;41(7):716-22. doi: 10.1016/j.oraloncology.2005.03.008.
• [4] Centromere protein F (CENPF), a microtubule binding protein, modulates cancer metabolism by regulating pyruvate kinase M2 phosphorylation signaling.Cell Cycle. 2018;17(24):2802-2818. doi: 10.1080/15384101.2018.1557496. Epub 2018 Dec 17.
• [5] Overexpression of CENPF correlates with poor prognosis and tumor bone metastasis in breast cancer.Cancer Cell Int. 2019 Oct 11;19:264. doi: 10.1186/s12935-019-0986-8. eCollection 2019.
• [6] Prediction of metastatic relapse in node-positive breast cancer: establishment of a clinicogenomic model after FEC100 adjuvant regimen.Breast Cancer Res Treat. 2008 Jun;109(3):491-501. doi: 10.1007/s10549-007-9673-x. Epub 2007 Jul 21.
• [7] CUGC for Stromme syndrome and CENPF-related disorders.Eur J Hum Genet. 2020 Jan;28(1):132-136. doi: 10.1038/s41431-019-0498-y. Epub 2019 Sep 5.
• [8] Macrophage conditioned medium promotes colorectal cancer stem cell phenotype via the hedgehog signaling pathway.PLoS One. 2018 Jan 2;13(1):e0190070. doi: 10.1371/journal.pone.0190070. eCollection 2018.
• [9] HnRNPR-CCNB1/CENPF axis contributes to gastric cancer proliferation and metastasis.Aging (Albany NY). 2019 Sep 16;11(18):7473-7491. doi: 10.18632/aging.102254. Epub 2019 Sep 16.
• [10] CENP-F gene amplification and overexpression in head and neck squamous cell carcinomas.Head Neck. 2001 Feb;23(2):104-12. doi: 10.1002/1097-0347(200102)23:2<104::aid-hed1005>3.0.co;2-0.
• [11] Lymphoid-specific helicase promotes the growth and invasion of hepatocellular carcinoma by transcriptional regulation of centromere protein F expression.Cancer Sci. 2019 Jul;110(7):2133-2144. doi: 10.1111/cas.14037. Epub 2019 May 25.
• [12] Influenza Vaccination Coverage Among Health Care Personnel - United States, 2016-17 Influenza Season.MMWR Morb Mortal Wkly Rep. 2017 Sep 29;66(38):1009-1015. doi: 10.15585/mmwr.mm6638a1.
• [13] The kinetochore protein, CENPF, is mutated in human ciliopathy and microcephaly phenotypes. J Med Genet. 2015 Mar;52(3):147-56. doi: 10.1136/jmedgenet-2014-102691. Epub 2015 Jan 6.
• [14] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [15] DNA topoisomerase II and mitosin expression predict meningioma recurrence better than histopathological grade and MIB-1 after initial surgery.PLoS One. 2017 Mar 16;12(3):e0172316. doi: 10.1371/journal.pone.0172316. eCollection 2017.
• [16] The microRNA expression signature of small cell lung cancer: tumor suppressors of miR-27a-5p and miR-34b-3p and their targeted oncogenes.J Hum Genet. 2017 Jul;62(7):671-678. doi: 10.1038/jhg.2017.27. Epub 2017 Mar 9.
• [17] Identification of low intratumoral gene expression heterogeneity in neuroblastic tumors by genome-wide expression analysis and game theory.Cancer. 2008 Sep 15;113(6):1412-22. doi: 10.1002/cncr.23720.
• [18] Downregulation of CENPF Remodels Prostate Cancer Cells and Alters Cellular Metabolism.Proteomics. 2019 Jun;19(11):e1900038. doi: 10.1002/pmic.201900038. Epub 2019 May 8.
• [19] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [20] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [21] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [22] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [23] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [24] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [25] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [26] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [27] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [28] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [29] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [30] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [31] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [32] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [33] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [34] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [35] DNA methylation inhibits p53-mediated survivin repression. Oncogene. 2009 May 14;28(19):2046-50. doi: 10.1038/onc.2009.62. Epub 2009 Apr 13.
• [36] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [37] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [38] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [39] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [40] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [41] Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
• [42] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [43] Synergistic interaction of lovastatin and paclitaxel in human cancer cells. Mol Cancer Ther. 2001 Dec;1(2):141-9.
• [44] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [45] Differential gene expression in normal human mammary epithelial cells treated with malathion monitored by DNA microarrays. Environ Health Perspect. 2005 Aug;113(8):1046-51.
• [46] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [47] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [48] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [49] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [50] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [51] BET protein inhibitor JQ1 inhibits growth and modulates WNT signaling in mesenchymal stem cells. Stem Cell Res Ther. 2016 Feb 1;7:22. doi: 10.1186/s13287-016-0278-3.
• [52] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [53] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [54] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [55] The genome-wide expression profile of Scrophularia ningpoensis-treated thapsigargin-stimulated U-87MG cells. Neurotoxicology. 2009 May;30(3):368-76.
• [56] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [57] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [58] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [59] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [60] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [61] Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.