General Information of Drug Off-Target (DOT) (ID: OT7SRHV3)

DOT Name RNA-binding protein EWS (EWSR1)
Synonyms EWS oncogene; Ewing sarcoma breakpoint region 1 protein
Gene Name EWSR1
Related Disease
Central nervous system neoplasm ( )
Melanoma ( )
Advanced cancer ( )
Bone cancer ( )
Carcinoma ( )
Childhood kidney Wilms tumor ( )
Chondrosarcoma ( )
Chromosomal disorder ( )
Clear cell adenocarcinoma ( )
Clear cell sarcoma ( )
Colorectal carcinoma ( )
Ewing sarcoma/peripheral primitive neuroectodermal tumor ( )
leukaemia ( )
Leukemia ( )
Liposarcoma ( )
Lung neoplasm ( )
Metastatic malignant neoplasm ( )
Neuroblastoma ( )
Osteosarcoma ( )
Prostate neoplasm ( )
Rhabdomyosarcoma ( )
Soft tissue neoplasm ( )
Soft tissue sarcoma ( )
Wilms tumor ( )
Amyotrophic lateral sclerosis ( )
Frontotemporal dementia ( )
Linear skin defects with multiple congenital anomalies 1 ( )
Synovial sarcoma ( )
Bone osteosarcoma ( )
Fibrosarcoma ( )
Kidney neoplasm ( )
Prostate cancer ( )
UniProt ID
EWS_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2CPE
Pfam ID
PF00076 ; PF00641
Sequence
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN
SAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC
NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR
GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
Function
Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes.
Tissue Specificity Ubiquitous.
KEGG Pathway
Transcriptio.l misregulation in cancer (hsa05202 )

Molecular Interaction Atlas (MIA) of This DOT

32 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Central nervous system neoplasm DISFC18W Definitive Genetic Variation [1]
Melanoma DIS1RRCY Definitive Genetic Variation [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [3]
Bone cancer DIS38NA0 Strong Genetic Variation [4]
Carcinoma DISH9F1N Strong Biomarker [5]
Childhood kidney Wilms tumor DIS0NMK3 Strong Biomarker [6]
Chondrosarcoma DIS4I7JB Strong Biomarker [7]
Chromosomal disorder DISM5BB5 Strong Biomarker [8]
Clear cell adenocarcinoma DISYUGHZ Strong Genetic Variation [9]
Clear cell sarcoma DIS1MTE6 Strong Biomarker [10]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [11]
Ewing sarcoma/peripheral primitive neuroectodermal tumor DISD4VQC Strong Biomarker [12]
leukaemia DISS7D1V Strong Biomarker [13]
Leukemia DISNAKFL Strong Biomarker [13]
Liposarcoma DIS8IZVM Strong Biomarker [14]
Lung neoplasm DISVARNB Strong Genetic Variation [15]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [16]
Neuroblastoma DISVZBI4 Strong Biomarker [17]
Osteosarcoma DISLQ7E2 Strong Biomarker [18]
Prostate neoplasm DISHDKGQ Strong Biomarker [19]
Rhabdomyosarcoma DISNR7MS Strong Genetic Variation [20]
Soft tissue neoplasm DISP2OHE Strong Biomarker [21]
Soft tissue sarcoma DISSN8XB Strong Biomarker [22]
Wilms tumor DISB6T16 Strong Biomarker [23]
Amyotrophic lateral sclerosis DISF7HVM Moderate Autosomal dominant [24]
Frontotemporal dementia DISKYHXL moderate Genetic Variation [25]
Linear skin defects with multiple congenital anomalies 1 DISNYKBT moderate Genetic Variation [26]
Synovial sarcoma DISEZJS7 moderate Genetic Variation [27]
Bone osteosarcoma DIST1004 Limited Biomarker [18]
Fibrosarcoma DISWX7MU Limited Genetic Variation [28]
Kidney neoplasm DISBNZTN Limited Genetic Variation [29]
Prostate cancer DISF190Y Limited Biomarker [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 32 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
21 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of RNA-binding protein EWS (EWSR1). [30]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of RNA-binding protein EWS (EWSR1). [31]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of RNA-binding protein EWS (EWSR1). [32]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of RNA-binding protein EWS (EWSR1). [33]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of RNA-binding protein EWS (EWSR1). [34]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of RNA-binding protein EWS (EWSR1). [30]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of RNA-binding protein EWS (EWSR1). [35]
Selenium DM25CGV Approved Selenium increases the expression of RNA-binding protein EWS (EWSR1). [36]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of RNA-binding protein EWS (EWSR1). [37]
Benzatropine DMF7EXL Approved Benzatropine decreases the expression of RNA-binding protein EWS (EWSR1). [38]
Propofol DMB4OLE Approved Propofol increases the expression of RNA-binding protein EWS (EWSR1). [39]
Sevoflurane DMC9O43 Approved Sevoflurane increases the expression of RNA-binding protein EWS (EWSR1). [39]
Romidepsin DMT5GNL Approved Romidepsin decreases the expression of RNA-binding protein EWS (EWSR1). [40]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of RNA-binding protein EWS (EWSR1). [36]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of RNA-binding protein EWS (EWSR1). [42]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of RNA-binding protein EWS (EWSR1). [43]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of RNA-binding protein EWS (EWSR1). [44]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of RNA-binding protein EWS (EWSR1). [45]
geraniol DMS3CBD Investigative geraniol decreases the expression of RNA-binding protein EWS (EWSR1). [46]
Rapamycin Immunosuppressant Drug DM678IB Investigative Rapamycin Immunosuppressant Drug decreases the expression of RNA-binding protein EWS (EWSR1). [47]
CATECHIN DMY38SB Investigative CATECHIN increases the expression of RNA-binding protein EWS (EWSR1). [48]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of RNA-binding protein EWS (EWSR1). [41]
------------------------------------------------------------------------------------

References

1 Intracranial Ewing sarcoma: four pediatric examples.Childs Nerv Syst. 2018 Mar;34(3):441-448. doi: 10.1007/s00381-017-3684-7. Epub 2017 Dec 28.
2 Review of the medical literature and assessment of current utilization patterns regarding the use of two common fluorescence in situ hybridization assays in the diagnosis of dermatofibrosarcoma protuberans and clear cell sarcoma.J Cutan Pathol. 2018 Dec;45(12):905-913. doi: 10.1111/cup.13345. Epub 2018 Sep 27.
3 Super-enhancer-associated MEIS1 promotes transcriptional dysregulation in Ewing sarcoma in co-operation with EWS-FLI1.Nucleic Acids Res. 2019 Feb 20;47(3):1255-1267. doi: 10.1093/nar/gky1207.
4 PI3K/AKT signaling modulates transcriptional expression of EWS/FLI1 through specificity protein 1.Oncotarget. 2015 Oct 6;6(30):28895-910. doi: 10.18632/oncotarget.5000.
5 EWSR1 translocation in primary hyalinising clear cell carcinoma of the thymus.Histopathology. 2019 Sep;75(3):431-436. doi: 10.1111/his.13890. Epub 2019 Jul 19.
6 Efficacy of ONC201 in Desmoplastic Small Round Cell Tumor.Neoplasia. 2018 May;20(5):524-532. doi: 10.1016/j.neo.2018.02.006. Epub 2018 Apr 5.
7 Correlation of Classic and Molecular Cytogenetic Alterations in Soft-Tissue Sarcomas: Analysis of 46 Tumors With Emphasis on Adipocytic Tumors and Synovial Sarcoma.Appl Immunohistochem Mol Morphol. 2017 Mar;25(3):168-177. doi: 10.1097/PAI.0000000000000294.
8 siRNA associated with immunonanoparticles directed against cd99 antigen improves gene expression inhibition in vivo in Ewing's sarcoma.J Mol Recognit. 2013 Jul;26(7):318-29. doi: 10.1002/jmr.2276.
9 Salivary Gland Neoplasms: Does Morphological Diversity Reflect Tumor Heterogeneity.Pathobiology. 2018;85(1-2):85-95. doi: 10.1159/000479070. Epub 2017 Sep 21.
10 Intracranial Myxoid Variant of Angiomatoid Fibrous Histiocytoma: A Case Report and Literature Review.Cureus. 2019 Mar 18;11(3):e4261. doi: 10.7759/cureus.4261.
11 Alteration of microRNA-4474/4717 expression and CREB-binding protein in human colorectal cancer tissues infected with Fusobacterium nucleatum.PLoS One. 2019 Apr 5;14(4):e0215088. doi: 10.1371/journal.pone.0215088. eCollection 2019.
12 Prostatic carcinoma with neuroendocrine differentiation harboring the EWSR1-FEV fusion transcript in a man with the WRN G327X germline mutation: A new variant of prostatic carcinoma or a member of the Ewing sarcoma family of tumors?.Pathol Res Pract. 2020 Feb;216(2):152758. doi: 10.1016/j.prp.2019.152758. Epub 2019 Nov 22.
13 EWSR1/ELF5 induces acute myeloid leukemia by inhibiting p53/p21 pathway.Cancer Sci. 2016 Dec;107(12):1745-1754. doi: 10.1111/cas.13080. Epub 2016 Nov 25.
14 mRNA and protein levels of FUS, EWSR1, and TAF15 are upregulated in liposarcoma.Genes Chromosomes Cancer. 2011 May;50(5):338-47. doi: 10.1002/gcc.20858. Epub 2011 Feb 22.
15 Primary pulmonary myxoid sarcomas with EWSR1-CREB1 translocation might originate from primitive peribronchial mesenchymal cells undergoing (myo)fibroblastic differentiation.Virchows Arch. 2014 Oct;465(4):453-61. doi: 10.1007/s00428-014-1645-z. Epub 2014 Aug 19.
16 Primary cutaneous and subcutaneous Ewing sarcoma.Pediatr Blood Cancer. 2015 Sep;62(9):1555-61. doi: 10.1002/pbc.25535. Epub 2015 Apr 20.
17 Therapeutic targeting of circ-CUX1/EWSR1/MAZ axis inhibits glycolysis and neuroblastoma progression.EMBO Mol Med. 2019 Dec;11(12):e10835. doi: 10.15252/emmm.201910835. Epub 2019 Nov 11.
18 An EWS-FLI1-Induced Osteosarcoma Model Unveiled a Crucial Role of Impaired Osteogenic Differentiation on Osteosarcoma Development.Stem Cell Reports. 2016 Apr 12;6(4):592-606. doi: 10.1016/j.stemcr.2016.02.009. Epub 2016 Mar 17.
19 An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer.Cell Rep. 2016 Oct 25;17(5):1289-1301. doi: 10.1016/j.celrep.2016.10.001.
20 Expanding the Spectrum of Intraosseous Rhabdomyosarcoma: Correlation Between 2 Distinct Gene Fusions and Phenotype.Am J Surg Pathol. 2019 May;43(5):695-702. doi: 10.1097/PAS.0000000000001227.
21 What is new in epithelioid soft tissue tumors?.Virchows Arch. 2020 Jan;476(1):81-96. doi: 10.1007/s00428-019-02677-8. Epub 2019 Nov 4.
22 DNA methylation profiling distinguishes Ewing-like sarcoma with EWSR1-NFATc2 fusion from Ewing sarcoma.J Cancer Res Clin Oncol. 2019 May;145(5):1273-1281. doi: 10.1007/s00432-019-02895-2. Epub 2019 Mar 20.
23 Desmoplastic small round cell tumor of the parotid gland-report of a rare case and a review of the literature.Diagn Pathol. 2019 May 18;14(1):43. doi: 10.1186/s13000-019-0825-1.
24 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
25 EWSR1, a multifunctional protein, regulates cellular function and aging via genetic and epigenetic pathways.Biochim Biophys Acta Mol Basis Dis. 2019 Jul 1;1865(7):1938-1945. doi: 10.1016/j.bbadis.2018.10.042. Epub 2018 Nov 24.
26 Characteristic sequence motifs located at the genomic breakpoints of the translocation t(12;16) and t(12;22) in myxoid liposarcoma.Pathology. 2008 Oct;40(6):547-52. doi: 10.1080/00313020802320424.
27 Antitumor profile of the PI3K inhibitor ZSTK474 in human sarcoma cell lines.Oncotarget. 2018 Oct 12;9(80):35141-35161. doi: 10.18632/oncotarget.26216. eCollection 2018 Oct 12.
28 Sclerosing epithelioid fibrosarcoma of the kidney: clinicopathologic and molecular study of a rare neoplasm at a novel location.Ann Diagn Pathol. 2015 Aug;19(4):221-5. doi: 10.1016/j.anndiagpath.2015.04.005. Epub 2015 May 6.
29 Primary low-grade fibromyxoid sarcoma of the kidney in a child with the alternative EWSR1-CREB3L1 gene fusion.Pediatr Dev Pathol. 2014 Jul-Aug;17(4):321-6. doi: 10.2350/14-05-1487-CR.1. Epub 2014 Jun 4.
30 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
31 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
32 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
33 Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
34 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
35 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
36 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
37 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
38 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
39 The differential cancer growth associated with anaesthetics in a cancer xenograft model of mice: mechanisms and implications of postoperative cancer recurrence. Cell Biol Toxicol. 2023 Aug;39(4):1561-1575. doi: 10.1007/s10565-022-09747-9. Epub 2022 Aug 12.
40 Antitumor effects of histone deacetylase inhibitor on Ewing's family tumors. Int J Cancer. 2005 Sep 20;116(5):784-92. doi: 10.1002/ijc.21069.
41 Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
42 Targeting the epigenetic readers in Ewing sarcoma inhibits the oncogenic transcription factor EWS/Fli1. Oncotarget. 2016 Apr 26;7(17):24125-40. doi: 10.18632/oncotarget.8214.
43 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
44 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
45 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
46 Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
47 Rapamycin induces apoptosis of JN-DSRCT-1 cells by increasing the Bax : Bcl-xL ratio through concurrent mechanisms dependent and independent of its mTOR inhibitory activity. Oncogene. 2005 May 5;24(20):3348-57. doi: 10.1038/sj.onc.1208471.
48 Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.